KEGG   Chlamydia sp. S15-834C: C834K_0668Help
Entry
C834K_0668        CDS       T05716                                 

Gene name
recD_1
Definition
(GenBank) Exodeoxyribonuclease V alpha chain,exonuclease V subunit alpha,helicase, RecD/TraA family,Viral (Superfamily 1) RNA helicase
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
chla  Chlamydia sp. S15-834C
Pathway
chla03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:chla00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    C834K_0668 (recD_1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:chla03400]
    C834K_0668 (recD_1)
Enzymes [BR:chla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     C834K_0668 (recD_1)
DNA repair and recombination proteins [BR:chla03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     C834K_0668 (recD_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 HHH_4 AAA_19 SH3_13 UvrD_C_2 Viral_helicase1 HHH_5 AAA_11 Helicase_RecD PIF1 PhoH T2SSE NTPase_1 AAA_22 ABC_tran AAA_28 DUF2075 AAA AAA_12 RsgA_GTPase AAA_29 AAA_16 Thymidylate_kin AAA_18 TrwB_AAD_bind KTI12 MeaB UvrD-helicase Mg_chelatase
Motif
Other DBs
NCBI-ProteinID: SYX09116
UniProt: A0A3B0PW73
Position
I:724898..727105
Genome map
AA seq 735 aa AA seqDB search
MEKISGKLKSVLFEDHDSKETAAHMRIPYKGTIIVIKGQFPDSFLQIGMQLYLYGKWSEN
SNLGKYFQVYSYDSLEMGDNRGIVNYLTSKLVKGIGPKITEKIIEKFQNETADILDNQPE
RLIEIPGISQTRCDSLCSQLREQKDLRTTLLFLQQYNIAIHYGVRIYKKYKEHSIEKICE
DPFLLAREMEGIGFKTADLIATRLGVPLNSQSRLFAGIQHSLEELQEDGHTCYPLQGLAQ
AVEKLLNQDIPEKIIQTEEIISQIYSMQEKNLLHIQELETIPHVWVKHIYLAEKTVVSDL
KRILFSSRKIRPIDGNKAIQWVEDNLSLHLEQNQREAVRACFLEKIHIITGGPGTGKSTI
TKAILKIFEQVTYKIILAAPTGKAAKRMTEITGKHSVTIHALLQYDFKTRSFRKNYENPI
DCDLIIVDESGMMDTYLLYHFLKALPDHVIVILIGDVHQLPSIGPGNILKDIINSKKITV
TKLNKIFRQVHDSNIIINAHKVNEGEFPILYSESGRKDFLFFQKEDPQEAMDHIVHLVTQ
FIPKKYHIYPKDIQILAPMKKGILGIHNLNKVLKSALNPKQATLHGKFQSYAIGDKVMQI
RNNYNKEVFNGDIGYISMINFENKRVIVNMEGKYVVYSFSELDDLVLAYATSVHKYQGSE
SPCIVLPLHTSHFMMLYRNLLYTAITRGKQLVILVGTKKAIAIATRNDKAQHRCTGLVQA
LEQLTQPEQETFSFS
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaatttccggaaaattaaaaagcgtactttttgaagatcacgattcaaaagaa
accgctgcgcacatgagaataccctataagggtacgatcatcgttatcaaaggtcagttt
cctgattcttttctacaaatcggtatgcagctatacctgtatggaaaatggtcagaaaat
tcaaatttaggaaaatacttccaagtatacagttacgattctttggaaatgggcgataac
cgtggaatagtcaattatcttacctctaagcttgtcaaaggtatcggaccgaaaatcact
gagaagattattgaaaaattccaaaatgagactgctgatattcttgataatcaaccggaa
agattaattgaaattccaggaattagccaaacccgctgtgatagtttatgctcacaactt
cgcgaacaaaaagatctgagaactactcttcttttcttacaacaatataatatcgctatc
cactatggcgtaagaatttataaaaaatataaagagcattccatagagaaaatctgtgaa
gatcccttcctactcgctagagaaatggagggtattgggtttaaaacagctgatttgatc
gccacacgcttaggagtacccttaaactcacaaagtagattatttgcgggaatacagcat
tctctagaagaactccaagaagatggccatacttgttatcccctacaggggcttgctcaa
gctgtagagaaactcctaaatcaggatattcctgaaaaaattatacaaactgaagagatc
atctctcaaatatatagcatgcaagagaaaaatcttttgcatattcaagagttagaaacc
atacctcacgtctgggtaaagcatatttacttagcagaaaagactgtggtttctgattta
aaacggatcttattttcctccaggaaaattcgtcctatagatgggaataaagccattcaa
tgggttgaagacaatctaagccttcacttagagcaaaatcaaagggaagcggttcgtgca
tgttttttagaaaagattcatatcattaccggaggacctggaacaggaaaaagcaccatc
acaaaggctatcctgaagatatttgagcaggttacctataaaatcattctagcagcccct
acggggaaagcagcaaagcgtatgacagaaattactggaaagcattcggtgactattcat
gccctactacaatatgattttaagacacgttcatttcgtaagaattatgaaaatcccata
gattgcgatctaatcatagtcgatgaatctggaatgatggatacatatctcctctaccat
tttctaaaagcacttcctgaccatgtgattgttatcttgatcggagatgtgcatcagcta
cctagtattggccctggaaatatcttaaaagatattatcaattctaaaaaaatcacagta
accaaactgaataagatttttcgccaagtgcatgactcaaacatcattatcaatgctcat
aaagtcaatgaaggtgaattccctatactttattctgaatcgggacgtaaggatttctta
ttctttcaaaaggaagatccccaggaggccatggaccatattgtccacctagtcacacag
tttatccctaagaaataccatatttatcctaaagatattcagattcttgccccgatgaaa
aaaggtatcttaggaattcataatctcaataaagtactaaaatctgctttaaatcctaaa
caagcaactctccacggcaagtttcaatcctatgctattggagataaagttatgcaaatc
cgcaataactacaataaagaagtattcaatggagacattggctatatctccatgatcaac
tttgaaaataaacgtgttatagtaaatatggaaggaaaatacgttgtatattccttctca
gaacttgacgatcttgttttagcctatgccacttcggtacataaatatcagggaagtgaa
agtccctgtattgtccttcctttacatacatctcatttcatgatgctctataggaatctt
ctctacacagcaattacaaggggaaaacagcttgtcattctagtaggcacaaaaaaagca
attgctatagccacaagaaatgataaggcacaacatcgctgcacaggacttgtgcaagct
cttgaacaacttacacaacccgaacaagaaactttctcattttcatga

DBGET integrated database retrieval system