KEGG   Corynebacterium humireducens: B842_02790Help
Entry
B842_02790        CDS       T03576                                 

Definition
(GenBank) thymidylate kinase
  KO
K00943  dTMP kinase [EC:2.7.4.9]
Organism
chm  Corynebacterium humireducens
Pathway
chm00240  Pyrimidine metabolism
chm01100  Metabolic pathways
Module
chm_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:chm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    B842_02790
Enzymes [BR:chm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.9  dTMP kinase
     B842_02790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thymidylate_kin AAA_28 dNK AAA_18 AAA_33
Motif
Other DBs
NCBI-ProteinID: AJE32411
UniProt: A0A0B5D1C7
Position
560593..561204
Genome map
AA seq 203 aa AA seqDB search
MIIAIEGIDGAGKNTLTRAIRERVDADMLAFPRYETSVPAQLVQEALHGRMGDLTDSAYA
MATLFALDRHGAREQLAPYVDSDRIILLDRYVASNAAYSVARLRDATVADWVHDLEFGRL
GLPQPDLQVLLATEPETASQRAAQREAQDASRERDRYERDADLQQRTYDAYLGLAERSWA
GRWLVTTSADVVLQEIAHITQGL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcgcgatcgaggggatcgacggcgcgggcaagaacacgctgacgcgtgccatc
cgcgagcgtgtcgacgccgacatgctggcgttcccccgctacgagacctccgtgcccgcc
cagctggtgcaggaggccctgcatgggcgcatgggggacctcacggactccgcctacgcc
atggcgacgctgttcgcgctggaccggcacggggcgcgggagcagctcgcgccctacgtc
gacagtgaccggatcatcctgctcgaccgctacgtcgcctcgaacgccgcctactcggtg
gcgcggctgcgcgacgcgacggtggccgactgggtccacgacctcgagttcgggcggctc
ggcctgccgcagccggacctgcaggtgctgctggcgacggagccggagacggcgtcgcaa
cgcgccgcgcagcgggaggcgcaggacgcgagccgggagagggaccgttacgaacgtgac
gcggacctgcagcagcgcacctatgatgcatatctggggctcgccgagcggagctgggcg
ggtcgctggctagtgaccacgagcgcggacgtagtattgcaagagattgcacacataaca
caaggactgtga

DBGET integrated database retrieval system