KEGG   Corynebacterium humireducens: B842_03760Help
Entry
B842_03760        CDS       T03576                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
chm  Corynebacterium humireducens
Pathway
chm00071  Fatty acid degradation
chm00072  Synthesis and degradation of ketone bodies
chm00280  Valine, leucine and isoleucine degradation
chm00310  Lysine degradation
chm00362  Benzoate degradation
chm00380  Tryptophan metabolism
chm00620  Pyruvate metabolism
chm00630  Glyoxylate and dicarboxylate metabolism
chm00640  Propanoate metabolism
chm00650  Butanoate metabolism
chm00900  Terpenoid backbone biosynthesis
chm01100  Metabolic pathways
chm01110  Biosynthesis of secondary metabolites
chm01120  Microbial metabolism in diverse environments
chm01130  Biosynthesis of antibiotics
chm01200  Carbon metabolism
chm01212  Fatty acid metabolism
chm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:chm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B842_03760
   00630 Glyoxylate and dicarboxylate metabolism
    B842_03760
   00640 Propanoate metabolism
    B842_03760
   00650 Butanoate metabolism
    B842_03760
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B842_03760
   00072 Synthesis and degradation of ketone bodies
    B842_03760
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B842_03760
   00310 Lysine degradation
    B842_03760
   00380 Tryptophan metabolism
    B842_03760
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B842_03760
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B842_03760
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B842_03760
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chm04147]
    B842_03760
Enzymes [BR:chm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B842_03760
Exosome [BR:chm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B842_03760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJE32605
UniProt: A0A0B5D187
Position
754990..756192
Genome map
AA seq 400 aa AA seqDB search
MSNLTPHADDVVILAGARTPQGKLLGSLASLSAVDLGAHAVRHAVERAGIQPSDVDHVIL
GQVLQAGAGQNPARQTALKAGLDPRVVAETVNKVCLSGLDAVIHAARLIRLGDADVVVAG
GQESMTNAAHVVRGARQGKGYGAMELADTAEVDGLTDAAEGISMGVLTEGPLSSLNISRE
EQDEIAAASHQRAAAAQSAGVFDSEIAPISIPQRKGDPVVVSADEGIRANTTTESLSGLR
PAFTRDGSITAGNASPISDGAAAVVLTRRSWAEERGLDYLAVVGVAGQTGGPDNSLHSQP
SDSLKAALDRAGWEAGDLDFVEINEAFGAVAVQSLRDLDYPAEQCNIYGGAIALGHPIGA
SGARLVLTAARELDRRGAGKAGVSLCGGGGQGDALLLYRN
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacctcaccccccacgccgatgacgtcgtcatcctcgccggagcccgcaccccc
cagggcaagctcctcggttccctcgcctccctcagcgccgtggacctcggcgcccacgcc
gtccgccacgccgtcgaacgcgccggcatccagccctccgacgtcgaccacgtgatcctc
ggccaggttctccaggccggtgccggacagaacccggcccgccagaccgcactcaaggca
ggcctcgacccgcgggtcgtcgccgagaccgtcaacaaggtctgcctctccggcctcgac
gccgtcatccacgccgcccgcctcatccgcctcggtgacgccgacgtcgtcgtcgccggt
ggtcaggagtccatgaccaacgccgcccacgtcgtccgcggcgcccgccagggcaagggc
tacggcgccatggagctcgccgacaccgccgaggtagacggcctcaccgacgccgccgag
ggcatctccatgggcgtgctcaccgagggcccgctgtcctccctgaacatctcccgcgag
gagcaggacgagatcgccgccgcctcccaccagcgtgcggccgccgcccagtccgccggc
gtcttcgactccgagatcgcccccatctccatcccgcagcgtaagggcgacccggtggtc
gtctccgccgacgagggcatccgcgccaacaccaccaccgagtccctctccggcctgcgc
cccgccttcacccgtgacggctccatcaccgcgggcaacgcgtccccgatctccgacgga
gccgcagccgtcgtcctcacccgccgttcctgggcggaggagcgcggcctcgactacctg
gcggtcgtcggcgtcgccggccagaccggtggcccggacaactccctgcactcccagccc
tccgactccctcaaggccgcgctcgaccgcgccggctgggaggccggtgacctggacttc
gtcgagatcaacgaggctttcggtgccgtcgccgtccagtccctgcgcgacctcgactac
ccggccgagcagtgcaacatctacggcggtgccatcgccctcggacacccgatcggtgcc
tccggtgcccgcctggtcctcaccgcggcgcgggagctcgaccgtcgtggtgccggcaag
gcaggcgtgagcctgtgcggtggcggtggccagggcgacgccctgctgctgtaccggaac
tag

DBGET integrated database retrieval system