KEGG   Corynebacterium humireducens: B842_06820Help
Entry
B842_06820        CDS       T03576                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
chm  Corynebacterium humireducens
Pathway
chm00670  One carbon pool by folate
chm01100  Metabolic pathways
chm01120  Microbial metabolism in diverse environments
chm01200  Carbon metabolism
Module
chm_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:chm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    B842_06820
Enzymes [BR:chm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     B842_06820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-ProteinID: AJE33213
UniProt: A0A0B5DAK2
Position
1386346..1388010
Genome map
AA seq 554 aa AA seqDB search
MTAPLTDVAIAQAHTLEPITEIALRAGIPPEALITYGPTKAKVDITRLRPGRDVGKLILV
TGISPTPAGEGKSTVLIGLADALTRLGHSAAAALREPSQGPVMGIKGGAAGGGYSQIVPM
EDINLHFTGDFHAIAAATNTLAAMVDNHVQQGNALGIDSRRIVWQRCLDVNDRSLRSVIT
GLGGTAHGTPRETGFTITAASEIMAVLCLAADLPDLKERLARLTVAFTFDGTPVAADELG
ATGALAALMKEAINPNLVQTLGGTPAYVHGGPFANIAHGCNSLIATQVALRHSDIVLTEA
GFGSDLGAEKFFDIKARHGRLDVNAVVIVATIRSLKYNGGLPRTDLGTESLDHLREGVKN
LARHVANIQQFGATPIVALNLFTGDTAAERAFLRAWAKDFHVALAECEVWARGGEGAEDL
ARVVLENLSQGSSLLYDPERGVEHSIEVIARRIYRAEKIEYSPQALRDLAVLRENGWDRL
PVCISKTQYSFSDDPTALGAPTGHTLHVRQLIPRTGAGFIVVLTGAVMTMPGLPARPAAE
GIDIDDDGRITGLF
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaccgctcacggacgtcgccatcgcccaggcccacaccctggaacccatcacc
gagatcgccctccgcgcgggaatcccgccggaggcactcatcacctacggaccgacgaag
gcgaaggtggacatcacgcggctgcgtcccgggcgggacgtcggcaagctcattctcgtg
acgggcatctccccgacaccggcgggggagggcaagtccaccgtcctcatcgggcttgcc
gacgccctcacccgcctcggacactccgcggccgccgccctacgcgagccctcccagggc
cccgtcatgggcatcaagggcggtgccgcgggcggcggctactcgcagatcgtgccgatg
gaggacatcaacctccacttcaccggcgacttccacgccatcgccgcggcgacgaacacg
ctggcggcgatggtcgacaaccacgtccagcagggcaacgcgctgggcatcgactcccgc
cgcatcgtgtggcagcgctgcctcgacgtcaacgaccggtccctgcgcagcgtcatcacc
ggactcggcggcaccgcgcacggcaccccgcgggagaccggcttcaccatcaccgccgcc
tccgagatcatggccgtcctgtgtctggccgccgacctgccggacctcaaggaacgcctc
gcccggctcaccgtggccttcaccttcgacggcacgcccgtcgccgccgacgagctcggg
gcgaccggcgcgctggccgccctgatgaaggaggcgatcaaccccaacctcgtgcagacc
ctgggcggcacccccgcctacgtccacggcggacccttcgccaacatcgcccacggctgc
aactcgctcatcgcgacgcaggtcgcgctccggcactccgacatcgtgctcacagaggcc
ggtttcggctccgacctgggggccgagaaattcttcgacatcaaagcccgccacggccgc
ctcgacgtcaacgcggtggtcatcgtcgccaccatccgctcgctcaagtacaacggcggc
ctgccccgcaccgacctcgggaccgaatccctcgaccacctgcgggagggcgtgaagaac
ctggcgcgccacgtggccaacatccagcagttcggcgccacgcccatcgtcgcgctcaac
ctcttcaccggcgacaccgccgccgaacgggccttcctccgcgcctgggcgaaggacttc
cacgtcgcgctcgccgaatgcgaggtgtgggcccgcggcggggaaggggccgaggacctg
gcccgcgtcgtcctcgagaacctctcccagggttcctccctgctctacgacccggagcgt
ggcgtcgagcactccatcgaggtcatcgcccgtcggatctaccgggcggagaagatcgag
tactcgccgcaggccctgcgcgacctggcggtgctcagggagaacggctgggaccggctg
ccggtgtgcatctccaagacgcagtactccttcagcgacgaccccaccgccctcggcgcg
cccaccggacacaccctccacgtgcgtcagctcatcccgcgcaccggcgccggtttcatt
gtcgtgctcaccggcgccgtgatgaccatgcccggcctgcccgcccgcccggcagcggag
ggcatcgacatcgacgacgacgggcggatcacggggctgttctag

DBGET integrated database retrieval system