KEGG   Corynebacterium humireducens: B842_07370Help
Entry
B842_07370        CDS       T03576                                 

Definition
(GenBank) 5'-nucleotidase
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
chm  Corynebacterium humireducens
Pathway
chm00230  Purine metabolism
chm00240  Pyrimidine metabolism
chm00760  Nicotinate and nicotinamide metabolism
chm01100  Metabolic pathways
chm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:chm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    B842_07370
   00240 Pyrimidine metabolism
    B842_07370
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    B842_07370
Enzymes [BR:chm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     B842_07370
CD molecules [BR:chm04090]
 Proteins
  B842_07370
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:chm00537]
 Enzymes
  B842_07370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5_nucleotid_C
Motif
Other DBs
NCBI-ProteinID: AJE33323
UniProt: A0A0B5DAY4
Position
complement(1502192..1504132)
Genome map
AA seq 646 aa AA seqDB search
MSLRRFGRFLAATTTAALALSLAPAALAQDNTVEFSVSNITDFHGRLAEDDYNKEMGAAL
IAGLNNTINGDENVFTTSGDNVGGSAFISAITDDEYTIDFLNAAGVEASAVGNHEFDQGQ
DDLLNRIIPNSDFPILGANVYKEDDTRLLNASTVIEKNGVKIGFVGTVATTTADKVSPAG
IAGLEFRDPIAETNAEAQRLKDSGEADVVIALFHEDAARYVDGFDETYVDFLFGGDSHQQ
YAVADAPLPYAQSLEYGKVLTDVDFTFNTDTKTIDSIAIKQYDYAAVEELGIEEDPEVAQ
IVAEAKAQADVIGEEVIATIDNSFYRGSNADADAGSNRGVESTLNHLIAEAQRASLGALL
GQEIQIGFMNAGGVRADLPAGEVTYADVVTIQPFGNEVSVATMTGQAVLDTLENQWKPGG
ERPRLALGVSEGFTYTYDPAAEQGERIIDARLNGEPIDPNADYTVAASTFLFEGGDGLIN
PDDVRNINLVGYMDVQALIDYLKANESVEPRLKQSDIAVTVEEGELVTGETVTLNLASLN
YSTAGEPIAENVTVALGTTEVTAAIDNDFSQITTGLGEHGTATVELVVPEGEWTLADLVI
TTDAKQVAAPTPPADKNGGSAESSFGSAKSSLGSAKSSLSSVGSSR
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
gtgtctctccgtcgtttcggccgcttcctcgcagccacgaccaccgccgccctcgccctc
tccctcgctccggccgccctggcccaggacaacaccgtcgagttctcggtgtccaacatc
accgacttccacggccgtctcgcggaggatgactacaacaaggagatgggcgccgcactc
atcgccggcctcaacaacacgatcaacggtgacgagaacgtcttcaccacctccggtgac
aacgtcggtggttccgcgttcatctccgcgatcaccgacgacgagtacaccatcgacttc
ctcaacgccgccggagtcgaggcctccgcagtgggcaaccacgagttcgaccagggccag
gacgacctcctgaaccgcatcatcccgaactccgacttcccgatcctcggcgccaacgtc
tacaaggaggacgacacccgtctcctgaacgcgtccaccgtcatcgagaagaacggcgtg
aagatcggcttcgtcggcaccgtcgccaccaccaccgccgacaaggtctctccggccggc
atcgcgggcctggagttccgtgacccgatcgccgagaccaacgccgaggcgcagcgcctg
aaggactccggcgaggccgacgtcgtcatcgccctgttccacgaggacgccgcccgctac
gtcgacggcttcgacgagacctacgtcgacttcctcttcggtggtgactcccaccagcag
tacgccgtcgccgacgcgccgctcccgtacgctcagtccctggagtacggcaaggtcctc
accgacgtcgacttcaccttcaacaccgacaccaagaccatcgacagcatcgccatcaag
cagtacgactacgctgcggtcgaggaactcggaatcgaagaggatccggaagtggctcag
atcgtcgccgaggccaaggcccaggccgacgtcatcggcgaggaagtcatcgccaccatc
gacaactccttctaccgcggctccaacgccgatgcggacgcgggatcgaaccgcggtgtc
gagtcaaccctcaaccacctgatcgccgaggcacagcgtgcctccctcggtgccctcctg
ggccaggagatccagatcggcttcatgaacgccggcggcgtccgcgcggatctgccggcc
ggcgaggtcacctacgccgacgtggtcaccatccagccgttcggcaacgaggtctcggtc
gccacgatgaccggacaggccgtcctggacaccctggagaaccagtggaagcccggcggc
gagcgtccgcgcctggcgctgggtgtctccgagggcttcacctacacctacgacccggct
gccgagcagggcgagcggatcatcgacgcccgcctgaacggcgagccgatcgatccgaac
gccgactacaccgtcgccgcctccaccttcctcttcgagggtggtgacggcctgatcaac
ccggacgatgtccgcaacatcaacctggtcggctacatggacgtccaggctctcatcgac
tacctgaaggccaacgagtccgtcgagccgcgcctcaagcagtccgacatcgctgtcacc
gtcgaggagggcgagctcgttaccggcgagaccgtcaccctgaacctggcctccctgaac
tactccaccgccggcgagccgatcgccgagaacgtcaccgtggcgctgggcaccaccgag
gtcaccgcggcgatcgacaacgacttctcccagatcaccaccggtctgggcgagcacggc
accgccaccgtggaactggttgttcccgagggtgagtggaccctcgccgacctggtcatc
accacggacgctaagcaggttgccgccccgaccccgccggctgacaagaatggcggttcc
gccgagtcgtccttcggttccgccaagtcctccctgggctccgccaagtcctccctctcc
tccgtcggcagctcccgctag

DBGET integrated database retrieval system