KEGG   Corynebacterium halotolerans: A605_05650Help
Entry
A605_05650        CDS       T02472                                 

Definition
(GenBank) hypothetical protein
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
chn  Corynebacterium halotolerans
Brite
KEGG Orthology (KO) [BR:chn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:chn03009]
    A605_05650
Enzymes [BR:chn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     A605_05650
Ribosome biogenesis [BR:chn03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    A605_05650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_12 Ubie_methyltran Methyltransf_31 PCMT Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: AGF72136
UniProt: M1P661
Position
1205654..1206520
Genome map
AA seq 288 aa AA seqDB search
MLSDIIDVLADPVDGTPLSGADDFSRLVSESGHSYDVARQGYVTLAGGAGLRHEGDDMSM
INDRETFLSRGHFAPFVEAVTSSVHDSLDDAEVPDDAHPVILEVGAGTGYYLAHTLDDVI
GSRGVGLDVSVHAARHLAKCHPRVGAVAADVWARLPLRDASVDVITVVFAPRNAAEFARV
LKPGGQVIVLAADRGHLAELRDPLGIIDVEEGKVDRLIEQAAGHLRPVGGSEYIEFAMNL
DRDSIAAQIGMSPSARHIPAPELAERIASLPETMTVTARAGITRLQHA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgctttccgacatcatcgatgtgctcgccgacccggtcgacggcaccccgctgtccggt
gcggacgatttttcacgcctggtctccgagtccgggcacagctatgacgtggcccgccag
ggctacgtcaccctcgcgggtggcgcaggcctgcgccacgagggcgatgacatgtccatg
atcaatgaccgcgagaccttcctgtcccgcggtcatttcgcccccttcgtggaggcggtg
accagcagcgtgcacgactcgctcgacgacgccgaggtccccgacgacgcccaccccgtc
atcctggaggtcggcgccggcaccggttactacctggcgcacacgctcgatgatgtcatc
ggctcccgcggagtcggactcgatgtgtccgtccatgccgccaggcacctggccaagtgc
cacccgcgggtgggcgcggtcgccgccgacgtctgggcacgcctgccgctgcgcgacgcc
tccgtcgacgtcatcaccgtcgtcttcgccccgcgcaacgcggccgagttcgcccgcgtc
ctcaaacccggcgggcaggtcatcgtgctcgccgccgaccgcgggcacctcgccgagctg
cgcgacccgctcggcatcatcgacgtcgaggagggcaaggtcgaccgtctgatcgagcag
gccgccggccacctgcgccccgtgggcgggtccgagtacatcgagttcgccatgaacctg
gaccgggactccatcgccgcgcagatcggcatgagcccctcggcccgccatatcccggcc
cccgagctcgccgagcggatcgcctcactgccggagacgatgaccgtcaccgcccgtgcc
ggcatcacccgcctgcagcacgcctga

DBGET integrated database retrieval system