KEGG   Corynebacterium halotolerans: A605_09670Help
Entry
A605_09670        CDS       T02472                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase dihydrolipoyltransacetylase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
chn  Corynebacterium halotolerans
Pathway
chn00020  Citrate cycle (TCA cycle)
chn00310  Lysine degradation
chn00380  Tryptophan metabolism
chn01100  Metabolic pathways
chn01110  Biosynthesis of secondary metabolites
chn01120  Microbial metabolism in diverse environments
chn01130  Biosynthesis of antibiotics
chn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:chn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A605_09670 (aceF)
  09105 Amino acid metabolism
   00310 Lysine degradation
    A605_09670 (aceF)
   00380 Tryptophan metabolism
    A605_09670 (aceF)
Enzymes [BR:chn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     A605_09670 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H TetR_C_21
Motif
Other DBs
NCBI-ProteinID: AGF72936
UniProt: M1P8E4
Position
2111077..2113212
Genome map
AA seq 711 aa AA seqDB search
MAFSVEMPELGESVTEGTITQWLKSVGDTVEVDEPLLEVSTDKVDTEIPSPAAGVLLEIK
AEEDDTVDVGAVIATIGEEGESAGDSDSSDDEVNENAEQVDPSGGQDVAQVDPAQDSSEK
ATEAKGSSTDVEMPELGESVTEGTITQWLKSVGDTVEVDEPLLEVSTDKVDTEIPSPVAG
TLQEILAEEDDTVDVGAIIARIGSGEAPQAEEKEEDREVPSEEAIQESESKDEKDTVEEA
QEPESDDSGSADSADATDVEMPELGESVTEGTITQWLKSVGDTVEVDEPLLEVSTDKVDT
EIPSPVAGTLQEILAEEDDTVDVGAIIARIGSGEAPKKKEAPKKEEPKAEPKKEAKPEKK
EEPKKEAPKAEPIGRSPGDSSESEGKGAPKQESGKKVNNDNVPYVTPLVRKLADKHGVDL
NTVEGTGVGGRIRKQDVLAAAEGGAEGKDEKAAPKGERANWSTKSVDPAKAELIGTTQKV
NRIREITAAKMVESLQTSAQLTHVQEVDMTRVAELRKANKQAFVDKHGANPTYLVFIVKA
VAEALVSHPNVNASYNAETKEMTYHADVNIGIAVDTPQGLLVPVIKKAQDLSLPEIAKEI
VDLAERARNKKLRPDDLSGGTFTVTNIGSEGALLDTPVLTPPQAGILGTAAIEKRPVVVT
DEGVDSIAIRQMAYLPFTYDHQVVDGADAGRFITTIKDRLETADFESDLQL
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atggcgttctccgtagagatgcccgaactgggcgaatccgtcaccgaaggcactatcacc
cagtggctgaagtccgtcggcgacaccgtcgaggtcgacgagccgttgctcgaggtctcc
accgacaaggtcgacacggagatcccctccccggccgccggcgtgctgctggagatcaag
gccgaggaggacgacaccgtcgacgtcggcgccgtgatcgcgaccatcggcgaggagggt
gagtccgccggtgactccgattcttccgacgatgaggtcaacgagaacgccgagcaggtc
gatccctccggcggccaggatgtcgcgcaggtcgaccccgcacaggactcctccgagaag
gccaccgaagccaagggctcctccaccgatgtcgagatgccggagctgggcgagtccgtc
accgagggcaccatcacccagtggctgaagtccgtcggcgacaccgtcgaggtcgacgag
ccgctgctcgaggtctccaccgacaaggtcgacaccgagatcccctcccccgtcgccggt
accctccaggagatcctggccgaggaggacgacaccgtcgacgtcggtgccatcatcgcg
cgcatcggctccggcgaggccccgcaggccgaggagaaggaggaggaccgcgaggtcccg
tccgaggaagccatccaggagtccgaatccaaggatgagaaggacaccgtcgaggaggcc
caggagcccgagtccgacgactccggttccgctgactccgccgacgccaccgatgtcgag
atgccggagctgggcgagtccgtcaccgagggcaccatcacccagtggctgaagtccgtc
ggcgacaccgtcgaggtcgacgagccgctgctcgaggtctccaccgacaaggtcgacacc
gagatcccctcccccgtcgccggtaccctccaggagatcctggccgaggaggacgacacc
gtcgacgtcggcgccatcatcgcccgcatcggctccggcgaagccccgaagaagaaggag
gctccgaagaaggaagagcccaaggccgagccgaagaaggaagctaagcctgagaagaag
gaggagcccaagaaggaggctccgaaggctgagcccatcgggcggagccccggcgactcc
tccgagagtgagggcaagggcgccccgaagcaggagtccgggaagaaggtcaacaacgac
aacgtcccgtacgtcaccccgctggtgcgcaagctggccgacaagcacggcgtcgacctg
aacaccgttgagggcacgggcgtcggtggccgcatccgtaagcaggacgtcctggccgcc
gccgagggtggcgccgagggcaaggacgagaaggccgccccgaagggcgagcgcgccaac
tggtccaccaagtccgtggacccggccaaggccgagctgatcggtacgacccagaaggtc
aaccgcatccgcgagatcaccgccgccaagatggtcgagtccctgcagacctccgcgcag
ctgacccacgtccaggaggtcgacatgacccgggtcgcggagctgcgcaaggccaacaag
caggctttcgtggacaagcacggcgcgaacccgacctacctggtcttcatcgtcaaggcc
gtcgccgaggctctggtctcccacccgaacgtcaacgcgtcctacaacgccgagaccaag
gagatgacctaccacgctgatgtcaacatcggcatcgccgtggacaccccgcagggtctg
ctggtcccggtcatcaagaaggcccaggacctgtccctgccggagatcgccaaggagatc
gtcgacctggccgagcgtgcgcgcaacaagaagctgcgccccgacgacctgtccggcggc
accttcacggtgaccaacatcggctccgagggcgccctgctggacaccccggtgctgacc
ccgccgcaggccggcatcctgggcaccgccgcgatcgagaagcgcccggtcgtcgtcacc
gacgagggcgtggactccatcgccatccgccagatggcctacctgccgttcacctacgac
caccaggtggtcgacggtgccgacgcaggccggttcatcaccaccatcaaggaccgtctc
gagaccgccgacttcgagtccgacctgcagctgtaa

DBGET integrated database retrieval system