KEGG   Corynebacterium halotolerans: A605_11050Help
Entry
A605_11050        CDS       T02472                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
chn  Corynebacterium halotolerans
Pathway
chn00071  Fatty acid degradation
chn00072  Synthesis and degradation of ketone bodies
chn00280  Valine, leucine and isoleucine degradation
chn00310  Lysine degradation
chn00362  Benzoate degradation
chn00380  Tryptophan metabolism
chn00620  Pyruvate metabolism
chn00630  Glyoxylate and dicarboxylate metabolism
chn00640  Propanoate metabolism
chn00650  Butanoate metabolism
chn00900  Terpenoid backbone biosynthesis
chn01100  Metabolic pathways
chn01110  Biosynthesis of secondary metabolites
chn01120  Microbial metabolism in diverse environments
chn01130  Biosynthesis of antibiotics
chn01200  Carbon metabolism
chn01212  Fatty acid metabolism
chn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:chn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A605_11050
   00630 Glyoxylate and dicarboxylate metabolism
    A605_11050
   00640 Propanoate metabolism
    A605_11050
   00650 Butanoate metabolism
    A605_11050
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A605_11050
   00072 Synthesis and degradation of ketone bodies
    A605_11050
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A605_11050
   00310 Lysine degradation
    A605_11050
   00380 Tryptophan metabolism
    A605_11050
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A605_11050
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A605_11050
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A605_11050
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chn04147]
    A605_11050
Enzymes [BR:chn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A605_11050
Exosome [BR:chn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A605_11050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt Death
Motif
Other DBs
NCBI-ProteinID: AGF73210
UniProt: M1P0A5
Position
2432122..2433366
Genome map
AA seq 414 aa AA seqDB search
MSSTTPQDTDIVLCSPLRTPVGRYGGIFTDVPVQDLAATVVRAVVERTGIDAAEVDDLIL
GQAAPNGAAPALGRVVALDSGLGESVPGMQLDRRCGSGLQAVVTAAAHISAGAADLIIAG
GAESMSRTEYTVDADVRWGKKGGNMVFRDRLAEARETAGGRHHPIPGGMIETAENLRREY
SIDREAQDKLSVASHERAVAAQENGIFAEEIVPVTVPGKRRKDPEQVIDRDEHPRPGTSV
ESLAKLRPVMGRQDEEATVTAGNASGQNDGAAAMIVTTRAKARELNLTPVASLRGWAVAG
VAPETMGIGPVAATSKVLDRLDLTLDDIDLIELNEAFAAQALAVLSEWGIDAEDPRLNPL
GSGISLGHPVGATGARMLVTASHQLQRSDANTALVTMCIGGGQGLAAVLEKEEN
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccaccaccccgcaggacaccgacatcgtcctgtgctccccgctgcgcaccccc
gtcggccgctacggcggcatcttcaccgacgtgccggtccaggacctggccgccaccgtc
gtgcgcgccgtcgtcgagcgcaccggcatcgacgccgccgaggtcgacgacctcatcctc
ggccaggctgccccgaacggcgccgccccggccctgggccgcgtcgtcgccctcgactcc
ggcctgggtgagtccgtgccgggcatgcagctggaccgccgctgcggatccggcctgcag
gccgtggtcaccgccgccgcgcacatctccgccggggcggccgacctgatcatcgccggt
ggcgcggagtccatgtcgcgcaccgagtacaccgtcgacgccgacgtccgctggggcaag
aagggcggcaacatggtcttccgcgaccgcctcgccgaggcccgcgagaccgccggcggc
aggcaccacccgatcccgggcggcatgatcgaaacggccgagaacctgcgccgcgagtac
tccatcgaccgcgaggcccaggacaagctgtccgtggcctcccacgagcgggccgtcgcc
gcccaggagaacggcatcttcgccgaggagatcgtgcccgtgaccgtgccgggtaagcgc
cgcaaggatccggagcaggtcatcgaccgcgacgagcacccgcgcccgggcaccagcgtg
gagtccctggccaagctgcgcccggtcatgggccgccaggacgaggaggccaccgtcacc
gccggcaacgcctccggccagaacgacggcgcggccgccatgatcgtgaccacccgcgcc
aaggcccgcgagctgaacctgaccccggtggccagcctgcgcggctgggccgtcgccggc
gtcgccccggagaccatgggcatcggcccggtcgccgccaccagcaaggtcctcgaccgt
ctggatctcaccctcgacgacatcgacctcatcgagctcaacgaggccttcgccgcccag
gccctggccgtgctctccgagtggggcatcgacgccgaggacccgcgcctgaatccgctg
ggctccggcatctccctgggccaccccgtcggcgccaccggcgcccgtatgctcgtcacc
gcgtcccaccagctgcagcgcagcgacgccaacaccgccctggtcaccatgtgcatcggc
ggcggccagggcctggccgccgtgctcgagaaggaggagaactaa

DBGET integrated database retrieval system