KEGG   Corynebacterium halotolerans: A605_11450Help
Entry
A605_11450        CDS       T02472                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
chn  Corynebacterium halotolerans
Pathway
chn00220  Arginine biosynthesis
chn00250  Alanine, aspartate and glutamate metabolism
chn00471  D-Glutamine and D-glutamate metabolism
chn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chn00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A605_11450
   00220 Arginine biosynthesis
    A605_11450
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    A605_11450
Enzymes [BR:chn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     A605_11450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase STAS
Motif
Other DBs
NCBI-ProteinID: AGF73288
UniProt: M1NPH2
Position
complement(2518197..2519444)
Genome map
AA seq 415 aa AA seqDB search
MKTPIPDYLGQILDSVRDRDGGEVADYIPDLATAEPERLAAAVCTVSGNVYSAGDDGDEF
TMQSVSKPFVYALALQELGRDAVFDAVGMEPSGEAFHELSLEEGTHRPMNPMINAGAITV
NQLINGEDSSVEDRVEVIRGFFSELAARELKVNEWVTDSELEHADRNLSIAHMLRSHGII
RDNAHEAVLSYTRQCAIEVTVRDLAVMTATLANGGVQPVTGRRILNQDVCRLTLSVMSSA
GMYDAAGRWMATVGIPAKSGVSGGLIGTLPGQLGIATFSPRLNPQGNSVRGVHIFERLSE
EMGLHLMAADPSGTHAVRSIQSDGEDTVINLQGPVNFTAAENILDEISGREFPGERLILD
VSRVSGFHRMGRKMVKEGLRRLREDGFEVAIYDPEGVVADLEFSDGTHAESVEER
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaccccgatccccgactacctcggccagatcctcgacagcgtccgtgaccgggac
gggggcgaggtcgccgactacattcccgacctcgccaccgccgagcccgagcggctggcg
gcggccgtgtgcaccgtgtcgggcaacgtctacagcgcgggtgacgacggcgacgagttc
accatgcagtccgtctccaagcccttcgtctacgccctggccctccaggagctcggccgc
gacgccgtcttcgacgcggtcggcatggagccctcgggggaggccttccacgagctctcc
ctcgaggaggggacccaccggccgatgaacccgatgatcaacgccggggcgatcacggtg
aatcagctgatcaacggggaggactcgagcgtggaggaccgggtggaggtcatccgcggg
ttcttctccgagctggccgcccgggagctgaaggtcaacgagtgggtgaccgactccgaa
ctcgagcacgccgaccgcaacctctcgatagcgcacatgctgcgcagccacggcatcatc
cgcgacaacgcccacgaggcggtgctcagttacacccggcagtgcgccatcgaggtcacc
gtccgggacctggcggtcatgaccgccaccctggccaacggcggggtgcagccggtgacc
gggaggcggatcctgaaccaggacgtctgccggctgacactgtctgtgatgagctcggcg
ggcatgtacgacgccgccggccgctggatggccaccgtgggtatccccgccaagtccggg
gtttccggcggactgatcgggacactgccgggtcagctgggtatcgccaccttctcccca
cggctgaatccgcagggcaacagtgtgcgcggagtgcacatcttcgaacggctctccgag
gagatggggctgcatctcatggccgccgatccctccggcacgcacgccgtgcgctccatc
cagtccgacggcgaggacaccgtcatcaacctgcagggcccggtcaacttcacggcggcg
gagaacatcctcgacgagatctccggccgcgagttccccggcgagcgtctcatcctcgac
gtctcccgggtctccggcttccaccggatgggccgcaagatggtcaaggagggcctgcgc
cgcctgcgcgaggacggtttcgaggttgccatctacgaccccgagggcgtggtcgccgac
ctcgagttctccgacggcacgcacgccgagagcgtcgaggagcgctga

DBGET integrated database retrieval system