KEGG   Corynebacterium halotolerans: A605_11780Help
Entry
A605_11780        CDS       T02472                                 

Definition
(GenBank) succinate CoA transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
chn  Corynebacterium halotolerans
Pathway
chn00020  Citrate cycle (TCA cycle)
chn00620  Pyruvate metabolism
chn00650  Butanoate metabolism
chn01100  Metabolic pathways
chn01110  Biosynthesis of secondary metabolites
chn01120  Microbial metabolism in diverse environments
chn01130  Biosynthesis of antibiotics
chn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:chn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A605_11780
   00620 Pyruvate metabolism
    A605_11780
   00650 Butanoate metabolism
    A605_11780
Enzymes [BR:chn01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     A605_11780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans
Motif
Other DBs
NCBI-ProteinID: AGF73352
UniProt: M1NV30
Position
complement(2598540..2600042)
Genome map
AA seq 500 aa AA seqDB search
MTDRIANSELRSKLMSADEAAQFINNGDTVGMSGFTGAAYPKALPTAIADKAKEFHSKGD
EFKINVLTGASTAPDCDGVLAEADAINYRMPYQSDPIMRGKVNSAEMKYQDIHLSHSGLQ
VEQGFFGNIDVAVIEVTRITEEGHLIPSSGVGNNIEYLEEADKVILEVNEWQSLDLEGMA
DIYRVPHLPNRTPIPINNVGDRIGNTYIQIDTNKVVAVVETNAPDRNSPFKEPDEISKQI
AGNFLDFLEAEVAAGRLAYDRFIMQSGVGNVPNAVMAGLLDSKFENIQAYTEVVQDGMLD
LIDAGKMTVSSATSFALSPEYAEKMNAEAKKYRDHLVLRPLQISNSPEVIRRMGLISSNG
LIEADIYGNVNSTHVGGTRIMNGIGGSGDFTRNAFASTFISPSVAKDGAISAIVPFASHI
DHTEHDAMVIITEYGFADLRGLAPRDRVKKMIAVAHPDYRPLLEEYYERAAKNKFLQTPH
DLATAFDFHVNLAEKGSMKG
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgactgaccggattgcgaactccgagctgcgctccaagctgatgtccgccgatgaggcg
gcccagttcatcaacaacggtgacacggtcggcatgtccggcttcaccggtgcggcctac
cccaaggcgctgcccaccgccatcgccgacaaggccaaggagttccactccaagggtgac
gagttcaagatcaacgtcctgaccggcgcatcgaccgccccggactgtgacggcgtgctg
gccgaggccgacgcgatcaattaccgcatgccctaccagtcggacccgatcatgcgcggc
aaggtcaacagtgccgagatgaagtaccaggacatccacctgtcccactccggcctgcag
gtcgagcagggcttcttcggcaacatcgacgtcgccgtcatcgaggtcacccgcatcacc
gaggagggccatctcatcccgtcctccggtgtgggaaacaacatcgagtacctcgaggag
gccgacaaggtcatcctcgaggtcaacgagtggcagtcgctcgacctcgagggcatggcg
gacatctaccgcgtaccgcacctgccgaaccgcaccccgatcccgatcaacaacgtcggc
gaccgcatcggcaacacctacatccagatcgacaccaacaaggtcgtcgccgtggtggag
accaacgccccggaccgcaacagccccttcaaggagccggacgagatctcgaagcagatc
gccggtaacttcctcgacttcctggaggccgaggtcgccgcgggccgtctggcctatgac
cgattcatcatgcagtccggcgtgggcaacgtacccaacgccgtgatggcgggcctgctg
gactccaagttcgagaacatccaggcctacaccgaggtcgtccaggacggcatgctggat
ctcatcgacgccggcaagatgaccgtctcctccgccacctccttcgcgctgtcgccggag
tacgcggagaagatgaacgccgaggcgaagaagtaccgcgaccacctcgtcctgcgtccg
ctgcagatctccaactccccggaggtcatccgccgcatgggcctgatctcctccaacggt
ctgatcgaggccgacatctacggcaacgtcaactccacccatgtcggtggtacccgcatc
atgaacggcatcggcggctccggtgacttcacccgcaacgccttcgcgtcgaccttcatc
tccccgtcggtggccaaggacggggcgatctccgcgatcgtgccgttcgcgtcccacatc
gaccacaccgagcacgacgccatggtcatcatcaccgaatacggcttcgccgacctgcgt
ggtctggctccgcgtgaccgcgtgaagaagatgatcgccgtggcccacccggactaccgt
ccgctgctggaggagtactacgagcgtgcggcgaagaacaagttcctgcagaccccgcac
gacctggccaccgccttcgacttccatgtcaacctggccgagaagggttccatgaagggc
tag

DBGET integrated database retrieval system