KEGG   Cryptosporidium hominis: Chro.10337Help
Entry
Chro.10337        CDS       T00210                                 

Definition
(RefSeq) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cho  Cryptosporidium hominis
Pathway
cho00010  Glycolysis / Gluconeogenesis
cho00051  Fructose and mannose metabolism
cho00562  Inositol phosphate metabolism
cho01100  Metabolic pathways
cho01110  Biosynthesis of secondary metabolites
cho01130  Biosynthesis of antibiotics
cho01200  Carbon metabolism
cho01230  Biosynthesis of amino acids
Module
cho_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cho00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Chro.10337
   00051 Fructose and mannose metabolism
    Chro.10337
   00562 Inositol phosphate metabolism
    Chro.10337
Enzymes [BR:cho01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Chro.10337
Exosome [BR:cho04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Chro.10337
  Exosomal proteins of bladder cancer cells
   Chro.10337
  Exosomal proteins of melanoma cells
   Chro.10337
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 3414267
NCBI-ProteinID: XP_668007
Position
1
AA seq 250 aa AA seqDB search
MSRKYFVGGNFKCNGTKESLKTLIDSFKQVESSNSEVYVFPTSLHISLVKEFFGNDHPGV
FKIGSQNISCTGNGAFTGEVSCEMLKDMDIDCSLVGHSERRQYYSETDQIVNNKVKKGLE
NGLKIVLCIGESLSERETGKTNDVIQKQLTEALKDVSDLSNLVIAYEPIWAIGTGVVATP
EQAQEAHAFIREYVTKMYNSQVSSNLRIIYGGSVTPDNCNELIKCADIDGFLVGGASLKP
TFAKIIESAQ
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtctagaaagtactttgtgggtggtaacttcaagtgcaatggcacaaaagaatctcta
aagactctgattgattctttcaaacaagtggaatcaagtaattcagaggtttacgtattc
ccaacttcactacatatttcattggtcaaagagtttttcggtaatgatcatccaggagta
ttcaagattggatcacagaacatttcttgtaccggaaacggagcatttacgggcgaagtt
tcttgcgaaatgcttaaagatatggatattgattgttctttagtaggccattctgaaaga
agacagtactattcggaaactgaccaaatcgtaaataataaggtaaagaagggtttggag
aatggcctgaagattgttctttgtattggagagtcattaagtgagagagaaacaggaaag
accaatgatgtcatacagaagcagttgacggaagctttaaaggatgtgagtgatttatct
aacttagtcatagcttacgagccaatttgggctatcggaacaggagtagtagcaacacct
gagcaagctcaagaggctcatgcatttattagagaatatgttacaaagatgtataattcc
caagtatcttccaatttaagaataatttatggaggatcggtcactcctgataattgtaat
gaattaatcaaatgcgccgatattgatggtttccttgttggaggagcttcattgaagccg
acatttgcaaaaatcattgaatctgcacagtaa

DBGET integrated database retrieval system