KEGG   Cryptosporidium hominis: Chro.30248Help
Entry
Chro.30248        CDS       T00210                                 

Definition
(RefSeq) snoRNA binding domain
  KO
K14565  nucleolar protein 58
Organism
cho  Cryptosporidium hominis
Pathway
cho03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:cho00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    Chro.30248
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cho03009]
    Chro.30248
Ribosome biogenesis [BR:cho03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    Chro.30248
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT
Motif
Other DBs
NCBI-GeneID: 3413549
NCBI-ProteinID: XP_668690
Position
3
AA seq 465 aa AA seqDB search
MLVLFETPAGYGLFRVTNSKLLSMDTDEIAEYFQNPDKVQKSVSLEAFLRFKDTKSALVE
ATALVESKLSKGLSKFIKKNIPNPASESLAVADKVLGGLIKQKYEIDVVYNPKMQEVMRG
IRNQLTDLLTGLTEKDMKTMALSLSHSLGRFKLKFSPEKIDTMIIQAVALLDDLDRELNN
YAMRLKEWYGWHFPELGKIISDRDVYANCIKVIGFRHCTRDANLQSPPCNIPSEMEAEIK
QAAEISMGTEITEEDLKNIIELCDRVLELSEYRESLSTYLKTRMSTIAPNLTYMVGELIG
ARLISHAGSLMNLAKHPSSTVQILGAEKALFRALKTKKSTPKYGLIYHAAVVGQSAPKLK
GKISRILAAKLSLCIRVDALNDQNEPTVAIENKQYVERRLEELSNQLTSGRLSSTGGNKK
PSTPSYSPVKSKALGSYDSSMDIVGSKRKPSGDSQEGSPDKRSKH
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgttggtactttttgaaacgccggctggctatgggttgtttagagtaacaaactcaaag
ttactgagtatggatactgatgaaattgcggagtactttcagaacccagataaagttcag
aagtctgtttctctagaagcttttttgaggttcaaagatacaaagtcagcattagttgag
gcaacagctttggttgagtctaagttaagtaaaggtttatccaagttcattaagaagaat
attccaaaccccgcatcagaatctctagctgtcgcagacaaggttttaggaggtcttata
aagcaaaagtatgaaattgacgttgtttataatcctaagatgcaggaggtaatgagggga
attagaaaccaattaactgacttactcactggattaactgaaaaggatatgaaaactatg
gctttatcattatctcactcactagggcgatttaaattgaagtttagtccagagaagatt
gatacaatgattattcaagctgtagcattattagatgatttagatcgtgaattaaataat
tatgcaatgagattaaaagaatggtacggatggcatttcccagaacttggaaagattata
tcagaccgtgatgtgtatgcaaactgcatcaaggtgattggttttaggcattgtactcgt
gatgcaaatttacaatccccaccatgtaatattccaagtgaaatggaagctgagattaaa
caagctgcggagatttctatgggtacagaaattactgaagaggatttaaaaaatattata
gaactatgcgaccgtgttttggaactttcagagtatagggagtcactatctacatattta
aagactagaatgtccacaatcgctccaaaccttacatacatggttggagagcttattggc
gcccgtttaatttctcatgctggtagtttaatgaaccttgccaaacatccatctagtact
gtccaaattctgggtgcagagaaggctttatttagggctcttaagaccaagaagagcact
ccaaaatatggactcatatatcacgcggcagttgttgggcagtctgcacctaaactaaag
ggtaaaattagcagaatattggcagcaaagttatcattgtgcatccgcgttgatgctctt
aatgatcaaaatgaaccaactgtagcgatagaaaataaacaatatgtcgagagaagattg
gaagaacttagcaaccaattaacttcaggacgcctttcctccacaggagggaacaaaaaa
ccatcaaccccatcatatagccctgttaaatctaaagctctaggttcttacgattcgtca
atggatattgttggaagtaagaggaaaccttcgggagatagtcaagaaggctcaccagat
aaaaggtccaaacattag

DBGET integrated database retrieval system