KEGG   Cryptosporidium hominis: Chro.80398Help
Entry
Chro.80398        CDS       T00210                                 

Definition
(RefSeq) methionine -- tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cho  Cryptosporidium hominis
Pathway
cho00450  Selenocompound metabolism
cho00970  Aminoacyl-tRNA biosynthesis
cho01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cho00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Chro.80398
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Chro.80398
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cho01007]
    Chro.80398
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cho03016]
    Chro.80398
Enzymes [BR:cho01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Chro.80398
Amino acid related enzymes [BR:cho01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Chro.80398
Transfer RNA biogenesis [BR:cho03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Chro.80398
 Prokaryotic type
   Other AARSs
    Chro.80398
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-GeneID: 3414717
NCBI-ProteinID: XP_668537
Position
8
AA seq 562 aa AA seqDB search
MTKINTTYRNSSGKYYYFTTAINYTNGTPHMGHAYEIVTSDILVRIARLFGFNTRFQTGT
DEHGQKIAATAEKKGISPKELCDENVKQFKNMNEKLQISTDRFIRTTDTDHYESCKELWR
RCEAKGDIYLGKYNGWYNVREESFMTELEAKMLNYTDPISGLPLTKMEEPSYFFRITNYL
ESIKNHIIDNPEFIQPESSRESILARLEALGSNSEDLSISRASFSWGVPVPNDQEHVMYV
WFDALTNYITGLKWADFDNDLEENSLFNKYWENTVHIVGKDITWFHSVIWPAMLLSVGLS
LPKTIFAHGFVTAPDGKKMSKSLGNVVDPFEQIDKMGSDPFRYYLAREGRFGNDIKYQPS
SVLDYNNGELADTYGNLISRITNLTHKFCQGVAPSLSQSLLLDKPVDIDKVFEEYYLAWH
CFRIDECTQIAMDLSRNVNKFLTDHAPWNKDNGKSDEERIEIIRIVLEGSYYISILLSPF
ITLACKEVFNRLGTPEKIIPEVDINYNNIKPGTPILIGEPLFKRIVNKEEKTFEELKAEK
KEREKQRRSGNKKLSETKDKGK
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgactaagataaatacaacatacagaaactcgtcgggaaaatattactatttcacgact
gcaataaactatacgaatggaacaccacatatggggcacgcatatgaaatagtaacttct
gatattcttgttagaattgcaaggctattcggctttaatacaagatttcaaacaggaact
gatgaacatgggcaaaaaattgcagctactgcagaaaaaaaaggcatatctccaaaagaa
ctttgcgatgaaaatgtaaaacaatttaaaaatatgaatgaaaaacttcagattagtacg
gacaggtttattagaacaactgatactgatcattatgaatcatgtaaggagttatggaga
cgttgtgaggcgaaaggagacatttaccttggaaagtataatggatggtataacgtaaga
gaagaaagttttatgactgaattagaagcaaaaatgctaaattatactgacccaatttcg
ggattacctttaacaaagatggaagaaccttcgtactttttcagaataactaattatctt
gaatcaataaaaaaccacattattgacaatccagaatttatacagccggaatcgagtaga
gaaagtatattagcaaggttagaggctcttggcagcaattctgaggacttatctataagt
agagctagtttttcctggggagttcccgttccaaatgaccaggaacatgttatgtatgtt
tggtttgatgctctaacaaattatattactggtttgaaatgggctgattttgataatgat
cttgaggaaaattcgttatttaacaagtattgggaaaatacagttcatatcgttggtaaa
gatattacttggttccattccgtaatctggcctgcgatgctattaagtgtcggacttagc
ttgccaaaaacaatttttgctcatggatttgttaccgcacccgacggtaaaaaaatgagc
aagagcttggggaatgttgttgatccattcgaacaaattgataaaatgggttctgatcca
tttagatattacttggctagagaagggagatttgggaatgatattaaatatcaaccttct
tccgttttagactataataatggtgaattagctgatacttatgggaatcttatttcaaga
attacaaatttaactcacaaattttgccagggagttgcgccttctttatctcaatcttta
ttgttggataaaccagtagatattgataaagttttcgaagaatattatttggcttggcat
tgtttccgtattgatgagtgcacgcaaatagcaatggatttgtcgaggaatgttaataag
ttccttactgaccacgcaccttggaacaaagataatggcaagtctgatgaagagaggata
gaaattattagaatcgtattggaaggttcctactatatttcaattctgcttagtccattt
attactttggcatgtaaggaggttttcaatagacttggaactccagagaaaataatccca
gaagttgatataaactataataacattaaacctggcacgccaatattgatcggtgaacct
ctatttaagagaattgtgaataaggaagaaaagacattcgaagagcttaaagcagagaaa
aaagaaagagagaaacaaagaagatcaggaaataagaaattaagtgaaactaaagataag
ggaaaatag

DBGET integrated database retrieval system