KEGG   Chondrocystis sp. NIES-4102: NIES4102_05570Help
Entry
NIES4102_05570    CDS       T05085                                 

Definition
(GenBank) HAD family hydrolase
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
chon  Chondrocystis sp. NIES-4102
Brite
KEGG Orthology (KO) [BR:chon00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:chon01009]
    NIES4102_05570
Enzymes [BR:chon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     NIES4102_05570
Protein phosphatases and associated proteins [BR:chon01009]
 HAD phosphatases
  Other HAD phosphatases
   NIES4102_05570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: BAZ43556
UniProt: A0A1Z4RM81
Position
613760..614437
Genome map
AA seq 225 aa AA seqDB search
MFKPITHIIYDVDGLLLDTESLNEKINSTIAQRYDKTFNLDLKMAIAGRTTIDSATIIVN
TLQLPLTVEAYLAERNKLIYPLYPSCQTLPGAIKLIEHLSCHQIPQALASSSSRHHFGLK
TINHQQWVKLFQVVTLGDDCELKHGKPAPDIFLLTAQRLNAAPQQCLVFEDSIAGMQAAK
EAGMSVIAIPDPIFDHDLFTAADQVLNSLLEFQPQVWNLPAYSFL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaacctattactcacattatctatgatgtggatggcttgctattagatacagaa
tctctcaatgaaaaaattaatagcaccattgcacaacgctatgataaaacctttaatctt
gatcttaagatggcgatcgctggacgcacaactatagattccgccaccattattgttaat
actttgcaactacccctaactgttgaagcctatcttgcagaacgaaataaattaatatat
cctttgtatcctagttgtcaaactttacctggggcgatcaaactaattgaacatctatct
tgtcatcaaattccccaagcacttgcttctagttcctcacgtcatcattttgggcttaaa
accattaatcatcagcaatgggtgaaattatttcaggtagtaactttaggagacgactgt
gaactaaaacacggaaaacctgcaccagatatatttttacttaccgcccaaagattaaat
gctgctcctcaacaatgtttagtatttgaagattccatcgctggtatgcaggcagccaaa
gaggcaggaatgtcggtaatagctattcccgatcctatatttgaccatgatttattcacc
gcagcagatcaagtacttaattccctcctagagtttcaacctcaagtttggaatttaccc
gcttatagttttttatga

DBGET integrated database retrieval system