KEGG   Caulobacter henricii: AQ619_02455Help
Entry
AQ619_02455       CDS       T04110                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
chq  Caulobacter henricii
Pathway
chq00430  Taurine and hypotaurine metabolism
chq00460  Cyanoamino acid metabolism
chq00480  Glutathione metabolism
chq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    AQ619_02455
   00460 Cyanoamino acid metabolism
    AQ619_02455
   00480 Glutathione metabolism
    AQ619_02455
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:chq01002]
    AQ619_02455
Enzymes [BR:chq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     AQ619_02455
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     AQ619_02455
Peptidases and inhibitors [BR:chq01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   AQ619_02455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: ALL12315
UniProt: A0A0P0NWA3
Position
complement(507373..509106)
Genome map
AA seq 577 aa AA seqDB search
MRRLILISLLALSACAGLADAQVTTRAKPAAAAAAGSQTAPRGFVAAANPLAVEAGLKVL
REGGSAVDAAVAVQAVLSLVEPQSSGIGGGAFMTYFEARTGKVTAYDGRETAPSGAAPDM
FLGPEGKPLPFQVAVVSGRATGVPGAVAMLAQAQKDHGAAKWSTLFKEAERLATDGFVVS
PRLAGMVNSSRVPQNATPDVTAYFTKPDGQRYQAGDLLKNPAYAATVRRLAAEGPSALYE
GPIAQAIVDKVQAGTLPGSITLSDLKTYRPRSAAALCRPWKVYTVCVPNPSSSGLAVVQA
LMMLEHTDIGTRGPKDPAAWALLAEAERVMYADRDRYVADPAFVKVPVEGLLDPAYVAER
AKLIKDVAGPAPKFGLPKGAPVVGPDATREPAGTTHFVIMDPAGNVVSMTTTVESIFGSG
RMVGGFFLNNQMTDFSFSPTDRDGAPAANAVAAGKRPRSSMSPLIVLDDKGKFLAAVGSP
GGNAILSYNLKAMVGVFYWGLSMQEAINLPNLVSRGENFSGEANLFGPEMVAALNARGVT
VKIGQNETSGLHGLIVRPGGVLEGGADPRREGVAKGL
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgcctcatcctgatctccctgctcgccctgtccgcctgcgccggcctggccgac
gcccaggtcacgacccgggccaagcccgccgcagcggccgctgcagggtctcaaaccgcg
ccgcgcggctttgtcgccgctgccaaccccctggcggtcgaggcgggcctgaaggtgctg
cgcgagggcggcagtgccgtggatgctgccgtagcggtccaggctgtgctgagcctggtc
gagccgcagagctcggggatcggcggcggtgccttcatgacctatttcgaggcgcgcacc
ggcaaggtcaccgcctatgacgggcgcgagacggcccccagcggcgccgcccctgacatg
ttcctgggcccggaaggcaagcccctgccgttccaggtcgccgtggtctccggccgggca
accggcgtcccgggtgccgtggccatgctggcccaggcccagaaggatcatggcgcggcc
aagtggagcaccctgttcaaggaggccgagcgactggcgaccgacggctttgtggtcagc
ccccgcctggccggcatggtcaacagcagccgggtgccccagaacgccacgccggacgtg
accgcctatttcaccaagcccgacggccagcgctaccaggccggcgatctgctgaagaac
ccggcctatgcggccacggtccggcggctggcggccgagggtcccagcgccctctatgaa
ggaccgatcgcccaggccatcgtcgacaaggtccaggccggcaccctgccgggcagcatc
accctcagcgatctcaagacctatcgcccccgctcggcggcggccctgtgccggccctgg
aaggtctatacggtctgcgtgcccaatccctcgtcgagtggcctggccgtggtccaggcc
ctgatgatgctggaacacaccgatatcggcacgcgcggccccaaggatccggccgcctgg
gccctgctggccgaggccgagcgggtcatgtacgccgaccgcgaccgctatgtggccgat
ccggccttcgtcaaggtgccggtcgagggcctgctggacccggcctatgtcgccgagcgc
gccaagctgatcaaggacgtggccggccccgcgccgaagttcggcctgccgaaaggcgcg
cccgtcgtcggccccgacgctacccgggagcctgccggcaccacccatttcgtgatcatg
gatccggccggcaatgtggtctccatgaccaccacggtcgagagcatcttcggctcgggc
cggatggtcggcggcttcttcctcaacaaccagatgaccgacttcagcttctcgccgacc
gaccgggacggtgcgccggcggccaatgcggtggcggccggcaagcgtccgcgctcgtcc
atgtcgccgctgatcgtgctggacgacaagggcaagttcctggcggccgtgggctcgccc
ggcggcaatgccatcctgtcctataatctgaaggccatggtcggggtcttctattggggc
ctctccatgcaggaggcgatcaacctgcccaacctggtgtcgcgcggcgaaaacttctcc
ggcgaggccaacctgttcggtcccgagatggtcgctgccctcaatgcccgcggcgtgaca
gtcaagatcggccagaacgagacctccggcctgcacggcctgatcgtgcgtcccggcggg
gtcctggagggcggtgccgatccccgtcgcgaaggcgtggccaagggcctgtag

DBGET integrated database retrieval system