KEGG   Caulobacter henricii: AQ619_05740Help
Entry
AQ619_05740       CDS       T04110                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
chq  Caulobacter henricii
Pathway
chq00071  Fatty acid degradation
chq00072  Synthesis and degradation of ketone bodies
chq00280  Valine, leucine and isoleucine degradation
chq00310  Lysine degradation
chq00362  Benzoate degradation
chq00380  Tryptophan metabolism
chq00620  Pyruvate metabolism
chq00630  Glyoxylate and dicarboxylate metabolism
chq00640  Propanoate metabolism
chq00650  Butanoate metabolism
chq00900  Terpenoid backbone biosynthesis
chq01100  Metabolic pathways
chq01110  Biosynthesis of secondary metabolites
chq01120  Microbial metabolism in diverse environments
chq01130  Biosynthesis of antibiotics
chq01200  Carbon metabolism
chq01212  Fatty acid metabolism
chq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:chq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AQ619_05740
   00630 Glyoxylate and dicarboxylate metabolism
    AQ619_05740
   00640 Propanoate metabolism
    AQ619_05740
   00650 Butanoate metabolism
    AQ619_05740
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AQ619_05740
   00072 Synthesis and degradation of ketone bodies
    AQ619_05740
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AQ619_05740
   00310 Lysine degradation
    AQ619_05740
   00380 Tryptophan metabolism
    AQ619_05740
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AQ619_05740
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AQ619_05740
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AQ619_05740
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chq04147]
    AQ619_05740
Enzymes [BR:chq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AQ619_05740
Exosome [BR:chq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AQ619_05740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ALL12894
UniProt: A0A0P0NXU8
Position
complement(1221192..1222430)
Genome map
AA seq 412 aa AA seqDB search
MPEALIIDACRTPRGIGKVGKGALADFHPQHLAATVLRALADRNGLNTAEVDDIIWGTST
QRGKQGGDLGRMAALDAGYDVRASGMTLDRFCGSGITTVNLAAASIMSGMEDLVIAGGTE
MMSYTAATADRTSPGLLDSGNLRLRARHPQSHQGVCADAIATLEGISRQALDELAVVSQQ
RADQAIREGRFDRALVPVLHEDGSVALDREEFPRPQTTLESLSQLKASFEMMAGVPIDEA
GTTLGGLIHQVYPDLKITHVHHAGNSSGVVDGAAAVLLASPAYAAAHGLKPRARVVAMAN
IGDSPTLMLNAPVPAARKVLAKAGLTVDDIDLWEINEAFAVVAEKFIRDLNLDRDKVNVN
GGAMALGHPIGATGSILIGTILDELERRDLKRGLVTMCAAGGMAPAIIIERL
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaagcactcatcattgacgcctgccgcacgccccgcggcatcggcaaggtcggc
aagggggccctcgcagactttcatccccagcatctggcggccaccgtcctgagggcactg
gcggaccgcaacggtctcaataccgccgaggtcgacgacatcatctggggcaccagcacc
cagcgtggcaagcagggaggggatctgggtcgcatggctgcgcttgacgccggctatgac
gtcagggccagcggcatgaccctcgaccgcttctgcggatcgggtatcaccacggtcaat
cttgccgcggcctcgatcatgtccggcatggaggatctggtgatcgccggcggaaccgag
atgatgtcctacacggccgcgacagcggaccggacttcgccgggtttgctggactcgggc
aatctacgcctccgcgcccggcacccgcagagccaccagggcgtctgcgccgacgccatc
gccactcttgaaggcatttcccggcaggctctcgacgaactggccgttgtcagtcagcag
cgggccgaccaggccatccgcgaaggacgcttcgaccgcgccctggtgccggtgttgcat
gaggacggcagcgtcgccctcgatcgggaagagtttccccgcccccagacgaccctcgag
agcctgtcccagctgaaggcctcgttcgaaatgatggccggcgtgccgatcgatgaggcg
ggcacgaccctgggcggtttgatccaccaggtctatccagatctgaaaatcacccacgtg
caccacgccggcaattcgtcgggcgtcgtcgatggtgccgcagcggtgctgctggcctcc
cccgcctatgccgctgcccatggcctgaaaccccgggcgcgggttgtggccatggccaac
atcggcgacagcccgaccctgatgctcaatgccccggtcccggccgcccgcaaggtcctg
gccaaggcgggactgacagtcgacgacatcgatctctgggaaatcaatgaggcctttgcc
gtcgtggctgagaagttcatccgcgacctgaacctcgaccgggacaaggtcaatgtgaat
ggcggggccatggctctcggccatcccatcggggcgaccggctcgatcctgatcgggacg
atcctcgacgagctggaacgccgggacctcaagcgcggcctggtgaccatgtgcgcggcc
ggcggcatggctccggccatcatcatcgagcgcctctga

DBGET integrated database retrieval system