KEGG   Caulobacter henricii: AQ619_08270Help
Entry
AQ619_08270       CDS       T04110                                 

Gene name
ndk
Definition
(GenBank) phosphodiesterase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
chq  Caulobacter henricii
Pathway
chq00230  Purine metabolism
chq00240  Pyrimidine metabolism
chq01100  Metabolic pathways
chq01110  Biosynthesis of secondary metabolites
chq01130  Biosynthesis of antibiotics
Module
chq_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
chq_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
chq_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:chq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AQ619_08270 (ndk)
   00240 Pyrimidine metabolism
    AQ619_08270 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:chq04131]
    AQ619_08270 (ndk)
Enzymes [BR:chq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     AQ619_08270 (ndk)
Membrane trafficking [BR:chq04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    AQ619_08270 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ALL13351
UniProt: A0A0P0NZ08
Position
1785439..1785858
Genome map
AA seq 139 aa AA seqDB search
MTERTFSILKPDATRRNLTGAINAVIEAAGLRIVAQRRVHLTDAQAKKFYEVHAERPFYG
ELVGQMTAEPVVVQVLQGDNAVARYREVMGATNPANADEGTIRKQFALSIGENSVHGSDS
LENAAIEIAQFFTEDQIVG
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaacgcaccttctcgatcctcaagccggacgccacgcgtcgcaacctgaccggc
gccatcaatgcggtgatcgaggccgccggcctgcgcatcgtcgcccagcgccgcgtgcat
ctcaccgatgcccaagccaagaagttctacgaagtgcacgccgagcgtccgttctacggc
gaactggtcggccagatgaccgctgagccggtcgtggttcaggttctgcaaggtgacaac
gccgtcgcccgctaccgcgaagtcatgggcgccaccaacccggccaatgccgacgagggc
accatccgcaagcagttcgccctgtcgatcggcgaaaactcggtccacggttcggacagc
ctggagaacgccgcgatcgagatcgcccagttcttcacggaagaccagatcgtcggctaa

DBGET integrated database retrieval system