KEGG   Chlamydia psittaci RD1: Cpsi_5331Help
Entry
Cpsi_5331         CDS       T02153                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
chr  Chlamydia psittaci RD1
Pathway
chr00030  Pentose phosphate pathway
chr00480  Glutathione metabolism
chr01100  Metabolic pathways
chr01110  Biosynthesis of secondary metabolites
chr01120  Microbial metabolism in diverse environments
chr01130  Biosynthesis of antibiotics
chr01200  Carbon metabolism
Module
chr_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
chr_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:chr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Cpsi_5331 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Cpsi_5331 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chr04147]
    Cpsi_5331 (zwf)
Enzymes [BR:chr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Cpsi_5331 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Cpsi_5331 (zwf)
Exosome [BR:chr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Cpsi_5331 (zwf)
  Exosomal proteins of colorectal cancer cells
   Cpsi_5331 (zwf)
  Exosomal proteins of bladder cancer cells
   Cpsi_5331 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: CBY17059
Position
complement(602525..604090)
Genome map
AA seq 521 aa AA seqDB search
MSRGLKSTMEMTSNENQDGGRTLPPCPPCVMVIFGATGDLTARKLFPALYHLIKEGRLSK
NFVCVGFARRKKSHEEFREEMKQAIQNFSRAQELDIRIWEEFESRIFYHESNFSSAEGYA
SLKERLEEIDKQYGTQGNRLFYLSTPPDYFPEIIENINKYKLFYHDQGEGKPWSRVIIEK
PFGVDLQSAKELQRYIDDNLDEDSVYRIDHYLGKETVQNILTIRFANTLFESCWNSQYID
HVQISVSESIGIGTRGNFFEKSGMLRDMVQNHMMQLLCLLTMEPPSVFNSEEIKKEKINI
LKKIRPFSKDDVIRGQYGTGEVQGVSVLGYREEENVNPASMVETYVALKMFIDNPRWLGV
PFYLRAGKRLAKRSTDISIIFKKSYATLFEPESCRICPIENDLLIIRIQPDEGVALQFNC
KVPGMNNVVRPVKMDFRYDTYFKTTAPEAYERLLCDCILGDRILFTSSDEVMASWELFTP
ILKQWEQDSSDVLFPNYVAGSAGPKEADKLLQADGKSWRPL
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgaggtctcaaaagtacgatggaaatgacaagtaatgaaaatcaagatggtggg
agaactttacccccgtgccccccttgtgtgatggtaattttcggtgctaccggcgatctt
acagcacgcaagttatttccagcattataccatctgatcaaagaaggcaggctatctaaa
aactttgtctgtgtaggctttgcaagaagaaaaaagagtcacgaagaatttcgtgaagaa
atgaaacaggctatacagaatttttcacgcgctcaagaactcgatatccgtatctgggag
gaattcgaatcacgcatattttatcacgaatcgaacttttcttctgcggaaggctatgct
tcgttgaaggaaagacttgaggagattgataagcaatatggaactcaagggaaccggcta
ttttatttatctacacccccagattatttccccgaaattattgaaaatattaataagtac
aaactgttctatcatgatcaaggagaaggcaaaccttggtcacgcgtgattatagaaaaa
ccttttggcgtagatttgcaaagtgccaaggagttgcaaagatacatagacgataattta
gatgaagactctgtctatcgcattgaccattatttaggaaaagaaaccgtacaaaatatc
ctcacgatacgttttgccaataccctatttgagtcttgttggaattctcaatatattgat
cacgtacaaattagcgttagcgaatccataggcataggtactcgaggaaatttctttgag
aaatccggaatgcttcgcgatatggtgcaaaaccatatgatgcagcttttatgtttactt
actatggaacccccttccgtattcaattctgaagagataaaaaaagaaaaaatcaacatc
cttaagaaaatacgtccattttctaaagatgatgtcatccgtggtcagtacggcacggga
gaagtccaaggagtgtctgttcttggctaccgcgaagaggaaaatgtcaacccagcttct
atggtagaaacttatgtagctttgaagatgttcatagataaccctcgttggttaggagtg
cctttctatctacgcgcaggaaaacgtctggctaaacgctctacagatatttctattatt
tttaaaaagtcctatgcgactttatttgaacccgaatcttgtcgtatttgtcctatagaa
aatgatctcctcattattcgtatacaaccagatgaaggcgtagctttgcaatttaactgt
aaagtccctgggatgaataatgtcgtgcgtcctgtgaaaatggattttcgctacgatacc
tattttaaaacaacagcccccgaagcttacgaaagattactttgtgattgcattttaggt
gataggattctctttacatctagtgatgaagtcatggcttcttgggagctttttacacca
attctaaagcagtgggaacaagattcttcagatgtgctcttccctaattatgttgccgga
tctgcgggacctaaagaggcggataaattactacaagccgatggcaaaagttggcgtcct
ttgtaa

DBGET integrated database retrieval system