KEGG   Chlamydia psittaci RD1: Cpsi_6981Help
Entry
Cpsi_6981         CDS       T02153                                 

Definition
(GenBank) putative aromatic amino acid hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
chr  Chlamydia psittaci RD1
Pathway
chr00360  Phenylalanine metabolism
chr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
chr00790  Folate biosynthesis
chr01100  Metabolic pathways
chr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:chr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Cpsi_6981
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cpsi_6981
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cpsi_6981
Enzymes [BR:chr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     Cpsi_6981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: CBY17213
Position
811922..812755
Genome map
AA seq 277 aa AA seqDB search
MTRHIAAILSNSESYSDALLNSRLALWKAYCPQVFFEYLDALNLTAGSVIDIDHINHTIL
SQTGLTLSSTKDYLPPHDYLFELSQQRFPIAKHIRKMEDESFSPLPDLIHDLFCHVPWLL
HQEFVKFFSSMGKLFIKAVERAKEIYSIEDQPRILNSNVLAISRCFWFTVENGLIEKQGK
RKAYGAAILSSTDQLSYTFNNNVFISPFKTEHIIQRPCNPKSLQTTFFIIRDFSELNDVA
EKMHLFLEQGRLDFIVFGPHDVYYQDIIYFLNEHVFS
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgactcgtcacatcgctgcaatactttccaactctgaaagttattcagatgcactgtta
aattctcgacttgctttatggaaggcttattgtccccaagttttttttgagtatttagat
gctctgaatctaactgcaggatcagtgatagatattgatcacattaaccatactatcctg
tcacaaacaggtcttacattatcctcaacaaaagattatctcccgccacacgattattta
tttgagttaagtcagcaacggtttcctatagctaaacacatacgcaaaatggaggatgaa
agtttttcgcctcttcctgatctcattcacgatttattttgccatgtcccatggttactg
catcaagaattcgtaaaatttttttcttctatggggaagctctttataaaagctgtagaa
cgagcaaaagaaatctattctatagaagaccagcctcgaatacttaacagcaatgttcta
gcaatctcgcggtgtttctggtttacagtagaaaacggtcttattgaaaaacagggaaag
agaaaagcatacggagctgctatattaagctccacagatcagttatcctatacctttaac
aacaacgtattcatttctccgtttaaaaccgaacacattatacaacgcccctgcaatcca
aaatccctacaaaccactttcttcatcattcgtgattttagcgaattaaatgacgttgca
gaaaaaatgcacctatttctagagcaaggacgacttgattttattgtctttggtccacac
gatgtatactatcaagatattatctattttttaaatgaacatgtcttttcataa

DBGET integrated database retrieval system