KEGG   Chlamydia psittaci RD1: Cpsi_8621Help
Entry
Cpsi_8621         CDS       T02153                                 

Definition
(GenBank) putative protoporphyrinogen-related protein
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
chr  Chlamydia psittaci RD1
Pathway
chr00860  Porphyrin and chlorophyll metabolism
chr01100  Metabolic pathways
chr01110  Biosynthesis of secondary metabolites
Module
chr_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:chr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cpsi_8621
Enzymes [BR:chr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Cpsi_8621
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Cpsi_8621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO NAD_binding_9 Thi4 MCRA
Motif
Other DBs
NCBI-ProteinID: CBY17372
Position
1001402..1002670
Genome map
AA seq 422 aa AA seqDB search
MKKAIIIGAGISGLSTAWWLHRKFPNSELVIIDKADRPGGLIYSDYQKNFALDLGPKGFL
VRGEGQYTLGLIRDLQLEEALIVSDKTAKKRFIRYKGKTRKVSPWTLIKEGLPFAIIKDL
FASRYTKDSSVYDFLSRHSTINLIHNVLNPVVTAIRAGHSHLLSAHMAFPSLSQREAKTG
SILRSFLKEPSKKKTSGAPYLASLRPNLGILIDTLVKKLPATWKFSSPVTKIECFPSQVV
VSTTQETFSGDLAIYTGATSLLPSLINIPGLQQLANKTLHWDLSCATLGWNRDMPSIPKG
YGMLFSDEPPLLGIVYNSRVFPNQMPGKTVLSLLLENRWHQEEAFAFSLAAISEYLGIST
KPDVFSLFSPEEGLPQHGVGFLEMKNQILPVLPHNLKIVGQNFSGPGLNRCVASAYQTVA
AI
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagccattatcataggcgcaggaatttcagggttatccacagcgtggtggtta
cataggaaattccccaatagcgaacttgtaattatagataaggcagatcgacctggtggg
cttatctactcagattaccaaaagaattttgccttggatctcgggcctaaaggttttcta
gtacgtggtgagggacagtataccctcggattaattcgtgatttacaactggaagaggct
ctcattgttagtgataaaaccgcgaaaaaacgttttatacgttacaaagggaaaacacga
aaagtctccccatggacattaataaaagaaggtttgcctttcgctatcatcaaagatctc
tttgcctcccgctatacaaaagatagctctgtatatgatttcctaagtcgccatagcaca
ataaatcttattcacaatgtattaaatcctgttgttaccgcaattcgtgcaggacacagt
catctactttctgctcatatggccttcccttccctttctcaacgcgaagcaaaaacagga
tccattttacgcagcttcttaaaagaaccttcgaagaaaaaaacatccggagctccttat
ctagcttcgctacgtcccaatctaggcatcctcattgatactttagtaaaaaaactaccc
gcaacgtggaagttttcttctcctgttacaaagatcgagtgtttcccatcccaggttgtc
gtatccactacacaagaaacattctcaggagatctagcaatatatacgggggccacgtct
ctacttccttctcttattaatattccaggactgcaacagcttgcgaataaaactcttcat
tgggatctctcgtgtgcaacattggggtggaatagggatatgccttctatccctaaaggt
tatggtatgctgttctctgacgaaccaccgttattaggtattgtctataactcacgagtc
ttccctaaccagatgcctgggaaaacagttctatcattactattagaaaaccgctggcat
caagaagaagctttcgctttttctttagcagcgatttctgagtatttagggatttctaca
aaacccgatgtattttcattattttccccagaagaaggtctacctcaacacggcgtaggg
tttttagaaatgaaaaatcagatactccctgtacttcctcataatctaaaaattgtcggg
caaaacttctctggtccaggattaaacagatgtgtagcctcagcctatcagactgttgct
gctatctaa

DBGET integrated database retrieval system