KEGG   Chromobacterium sp. IIBBL 274-1: DK843_05340Help
Entry
DK843_05340       CDS       T05744                                 

Definition
(GenBank) hypothetical protein
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
chrb  Chromobacterium sp. IIBBL 274-1
Pathway
chrb00010  Glycolysis / Gluconeogenesis
chrb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:chrb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DK843_05340
Enzymes [BR:chrb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     DK843_05340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: AXE33792
UniProt: A0A344UEU4
Position
1137739..1138368
Genome map
AA seq 209 aa AA seqDB search
MQTVGEQMSKTPEVLVFDLGGVLADWNGIDPLVRLSGGRLDREAARLFWIGNPWVAKLDL
GECEPQEFAAAMTDTLQLGISPEAMQRQLSDWLAGAYPGASELLADLAQRFPLAALSNNN
ALHWDKIEREFDLLRHFGHTFASHLLRLRKPDAAIYRHVQDTLGAAPEAIAFFDDNIECV
EAAQAQGWQAFHTKGLEQVRAALAAQGWL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacagttggagagcaaatgagcaagacacctgaagtgctggtattcgacctgggc
ggcgtattggccgactggaacggcatcgatccgctggtgcgcctgtccggcggtaggctg
gatcgcgaggccgcccgcctgttctggatcggcaacccctgggtggccaaactggatctg
ggcgagtgcgaaccgcaagagttcgccgccgcgatgacggacacgctgcagttgggcatc
agccccgaagccatgcagcggcagttgtcggactggctggccggagcctatccgggcgcc
agcgaactgctggccgatctcgcccaacgcttcccgctggccgcgctcagcaacaacaac
gcgctgcactgggacaagatagagcgggaattcgatctgctgcgccacttcggacacacc
ttcgcctctcacttgctgcgcctgcgcaagccggacgccgccatttaccgccatgtccag
gatacgctgggcgcggcgccggaggccatcgccttcttcgacgacaacatcgaatgcgtg
gaggccgcccaagcccaaggctggcaggccttccacaccaagggcctggaacaggtgcgc
gccgcgctcgcagcccagggctggttatga

DBGET integrated database retrieval system