KEGG   Chromobacterium sp. IIBBL 274-1: DK843_06070Help
Entry
DK843_06070       CDS       T05744                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
chrb  Chromobacterium sp. IIBBL 274-1
Pathway
chrb00360  Phenylalanine metabolism
chrb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
chrb00790  Folate biosynthesis
chrb01100  Metabolic pathways
chrb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:chrb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    DK843_06070
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DK843_06070
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DK843_06070
Enzymes [BR:chrb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     DK843_06070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AXE33911
UniProt: A0A344UF63
Position
complement(1284208..1285101)
Genome map
AA seq 297 aa AA seqDB search
MNDRADFVVPDITTRKNVGLSHDANDYTLPQPLERYTAEDHATWATLYARQSKLLPGRAC
DEFLQGLRDLEVDHDRVPDFEKLNEKLMAATGWRIVAVPGLIPDDVFFEHLANRRFPVTW
WLREPHQLDYLQEPDVFHDLFGHVPLLINPVFADYLEAYGKGGIKAKALGALPMLARLYW
YTVEFGLINTPAGMRIYGAGIVSSKSESIYCLDSASPNRVGFDLMRIMNTRYRIDTFQKT
YFVIDSFKQLFDATAPDFAPLYRELADSAPWSAGDIAPSDVVINEGDRQGWAETDDV
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaccgcgccgactttgtggtgcccgacatcaccacgcgcaagaatgtcggattg
agccacgacgccaacgactacactttgccgcagccgctggagcgctacaccgcggaagac
cacgccacctgggccacgctgtatgctcgccagagcaagctgttgccgggccgcgcctgc
gacgagttcctgcagggcctgcgcgatctggaagtggaccatgatcgggtgccggatttc
gagaagctcaacgagaagctgatggctgccaccggctggcggatcgtcgcggtgccgggg
ctgattcccgacgacgtgttcttcgagcatctggccaatcgccgcttcccggtcacttgg
tggctgcgcgagccgcaccagctggattacctgcaggagccggacgtgttccacgacctg
ttcggccacgtgccgctgctgatcaacccggtgttcgccgactatctggaggcctacggc
aaaggcggcatcaaggccaaggcgctgggcgcgctgcctatgctggcgcggctgtactgg
tacacggtggagttcggcctgatcaatacgccggccggcatgcgcatctacggcgcaggc
atcgtgtccagcaagtccgagtccatctattgcctggacagcgccagtcccaaccgcgtt
ggctttgacctgatgcgcatcatgaacacgcgctaccggatcgacaccttccagaagact
tacttcgtcatcgacagcttcaagcagttgtttgacgccaccgcgccggatttcgcgccc
ctgtaccgcgaattggccgacagcgcgccgtggagcgctggcgacatcgcgccgagcgac
gtggtgatcaacgagggagatcgccagggctgggcggagaccgacgacgtttga

DBGET integrated database retrieval system