KEGG   Chromobacterium sp. IIBBL 274-1: DK843_12395Help
Entry
DK843_12395       CDS       T05744                                 

Definition
(GenBank) histidine phosphatase family protein
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
chrb  Chromobacterium sp. IIBBL 274-1
Pathway
chrb00860  Porphyrin and chlorophyll metabolism
chrb01100  Metabolic pathways
Module
chrb_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:chrb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DK843_12395
Enzymes [BR:chrb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     DK843_12395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AXE35028
UniProt: A0A344UID0
Position
2574975..2575577
Genome map
AA seq 200 aa AA seqDB search
MNPYTLTLLRHGDIPHDGRLIGLTDLPLTELGHQQLEHSWKRISNLAPVTCIATSPLQRC
REFAVKQALAGSLTLKVDPRFAEMDFGGWDGQPVADLEREHPGWGADLANGRLSPPGGES
FEQFRTRALAGLADWMTEARGSHRLLITHGGVITVLMAELLGTEFSVAKLMTVQRGGFVQ
LSMLEGHPAYLLRLESACAD
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaacccttacaccctgaccctgctgcgccatggcgacattccgcacgacggccggctg
atcggcctgaccgacctgccgctgaccgaactgggccaccagcagctggagcatagctgg
aaacgcatcagcaacctggcaccggtcacctgcatcgccacatcgccgctgcagcgctgc
cgcgagttcgcggtcaagcaggcgctggccggctcgctgacgctgaaagtggacccgcgc
ttcgccgagatggacttcggcggctgggacggccagccggtggccgatctggagcgggag
caccccggctggggcgcggacctggcaaacggcaggctgtccccgcccggcggcgaaagc
ttcgagcaattccgcacccgcgcgctggccggcctggccgactggatgaccgaagcccga
ggcagccaccggctgctgatcactcatggcggcgtgatcacggtgctgatggccgagttg
ctgggcaccgaattttcggtggccaagctgatgacggtgcagcgcggcggcttcgtccag
ctgtcgatgctggaaggacatccggcctacctgctgcgcctggagtccgcatgcgcggac
tga

DBGET integrated database retrieval system