KEGG   Chromobacterium sp. IIBBL 274-1: DK843_15120Help
Entry
DK843_15120       CDS       T05744                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
chrb  Chromobacterium sp. IIBBL 274-1
Pathway
chrb00970  Aminoacyl-tRNA biosynthesis
chrb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chrb00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DK843_15120
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:chrb03029]
    DK843_15120
Enzymes [BR:chrb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     DK843_15120
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     DK843_15120
Mitochondrial biogenesis [BR:chrb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    DK843_15120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln DUF3861
Motif
Other DBs
NCBI-ProteinID: AXE35518
UniProt: A0A344UJS0
Position
3162026..3162313
Genome map
AA seq 95 aa AA seqDB search
MSLTHQDVARIAKLARINVSEAEIAATADQLNNIFGLIEKMQAVDTAGIEPMAHPQDVSL
RLRDDVVTEANRREAFQAVAPQVEKGLFLVPKVIE
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgacgcatcaggatgtcgcacggatcgccaagcttgcccgcatcaatgtgagc
gaggcggaaatcgccgccaccgcggaccagctcaacaatattttcggcctgatcgagaag
atgcaggccgtggacaccgccggcatcgagccgatggctcacccgcaggacgtttcgctg
cgcctgcgcgacgacgtggtgacggaagccaaccggcgcgaggccttccaggcggtcgcg
ccgcaagtggaaaaaggcctgttcctcgttcccaaagtgatcgagtaa

DBGET integrated database retrieval system