KEGG   Chromobacterium sp. IIBBL 274-1: DK843_16320Help
Entry
DK843_16320       CDS       T05744                                 

Definition
(GenBank) N-acetyltransferase
  KO
K13018  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase [EC:2.3.1.201]
Organism
chrb  Chromobacterium sp. IIBBL 274-1
Pathway
chrb00520  Amino sugar and nucleotide sugar metabolism
chrb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chrb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DK843_16320
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:chrb01005]
    DK843_16320
Enzymes [BR:chrb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.201  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase
     DK843_16320
Lipopolysaccharide biosynthesis proteins [BR:chrb01005]
 Unusual sugar
  DK843_16320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2
Motif
Other DBs
NCBI-ProteinID: AXE35735
UniProt: A0A344UKD7
Position
3397661..3398236
Genome map
AA seq 191 aa AA seqDB search
MNVQIHPSAIVDEGASLGEGTRVWHWVHICGGAKIGKDCSFGQNVFVGNDVLIGDNVKVQ
NNVSIYDAVTLEDDVFCGPSMVFTNVNNPRSHVNRKNEYRRTVVKKGASIGANATIVCGH
TVGEYAFIGAGAVVTRDVPAYALMVGAPAKRIGWMCGCGERLSNDIGTHTCPACGIHYEV
GGNHCTPIRHD
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtacagatccacccctctgccatcgtcgacgaaggcgcctctttgggcgaaggc
acccgcgtctggcactgggtgcacatctgcggcggcgccaaaataggcaaggattgctcc
ttcggtcagaacgtgtttgtcggcaacgacgtgctgattggcgacaacgtcaaggtgcag
aacaacgtgtcgatctacgacgcggtgacgctggaggacgacgtgttctgcggcccgtcc
atggtgttcaccaacgtcaacaatccgcgcagccacgtcaaccgcaagaatgaataccgc
cgcaccgtggtgaagaagggcgcctccatcggcgccaacgccaccatcgtctgcggccac
acggtgggcgagtacgccttcatcggcgccggcgcggtggtcacccgcgacgtgccggct
tacgcgctgatggtgggcgcgccggccaagcgcatcggctggatgtgcggttgcggcgag
cggctgtccaacgacatcggcacccatacctgcccggcttgcggcatccattacgaggtc
ggcggcaatcactgcacgccgatccggcacgactga

DBGET integrated database retrieval system