KEGG   Chromobacterium sp. IIBBL 274-1: DK843_16635Help
Entry
DK843_16635       CDS       T05744                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
chrb  Chromobacterium sp. IIBBL 274-1
Pathway
chrb03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:chrb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    DK843_16635 (recD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:chrb03400]
    DK843_16635 (recD)
Enzymes [BR:chrb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     DK843_16635 (recD)
DNA repair and recombination proteins [BR:chrb03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     DK843_16635 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Helicase_RecD Viral_helicase1 AAA_11 SH3_13 AAA_22 T2SSE UvrD-helicase UvrD_C AAA_16 DUF2075 Mg_chelatase CbiA AAA_24 AAA_25 FtsK_SpoIIIE AAA_26 TrwB_AAD_bind NACHT AAA_7 AAA_5 SRP54 ATPase Rad17 AAA_28
Motif
Other DBs
NCBI-ProteinID: AXE35787
UniProt: A0A344UKI9
Position
3460673..3462364
Genome map
AA seq 563 aa AA seqDB search
MRTDAPLLPAQLASLFQRLSPEVEDRVLALIGELGNANLAGHVCLPLAHRAESASLRNSP
LVGRPGDYAPLILDDAGRLYFARHWHDEDRLAQGLMRLAQPVPPPDEARLADLLSRLFPG
DGGQDRQKLAAALAARQRLMVISGGPGTGKTTTVVRLLALLAAMSPRPLVMAMAAPTGKA
AARLSESVRAARDRLDVDDAVRRQLPAQAETLHRLLGLRPGAEAPRHHAGNPLPLDVLVV
DEASMIDLSLMARMVAALPSQARLILLGDRDQLSSVEAGAVLGELCGRIAYRADTVDWLR
RVAGGSLDGDAAPGGTLTDCVALLTRSHRFGADSGIGELARRVNAGEGRASLLTLDDANW
PDVWRQEAACDADLLARRRGYLDAVAAGADADEVQRAFSAFMLLAAERRQVADCNRRVER
ELEAAGIKQPGRDWYPGRPVMIGENDYGLSLFNGDIGFALQRPSGLRVLFPSADGGWREF
SPGRLPAHETVFAMTVHKSQGSEYDEVWLQLPQQAGALLNRALLYTAITRARLRFAAVGD
ADVWLRGAELAPRRDSGLGDRLR
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgagaaccgatgcccccttgctgcctgcccaattggcgagtctgttccagcgcctgtcg
cccgaggtggaggacagggtgctggcgctgattggcgagcttggcaacgctaatctggcc
ggccatgtctgtctgccgctggcgcaccgggcagagtccgcgtcattgcggaacagcccc
ttggtcggccgccccggcgactatgcgccgttgatcctggatgatgccggcaggctgtac
ttcgcccgccactggcatgacgaggacaggctggcgcaggggctgatgcgcctggcgcag
ccagttccgccgccggacgaggcgaggctggcggatttgctgagccgcctgttccccggc
gacggcgggcaggaccggcagaaactggcggcggcgctggcggcgcggcagcggctgatg
gtgatttccggcggccccggcactggcaagaccacgactgtggtgcgtttgctggctttg
ctggcggcgatgtcgccgcggccgctggtgatggcgatggccgcgccgacaggcaaggcg
gcggcgcggttgtcggagtcggtgcgcgccgcgcgcgaccggctggacgtggacgatgcg
gtgcgccgtcagttgccggcccaggcggaaacgctgcaccggctgctggggctgcgcccc
ggcgcggaagcgccgcgccaccatgccggcaatccgttgccgctggacgtgctggtggtg
gacgaggcgtcgatgatagacctgtcgctgatggcgcggatggtggcggcgctgccgtcg
caggcccggctgatcctgctgggcgaccgcgaccagctgtcgtcggtggaggccggcgcg
gtgctgggcgaattgtgcggccgcatcgcctaccgcgcggacaccgtagactggctgcgg
cgggtggctggcggcagtttggatggcgatgccgcgccgggaggcacgttgaccgattgc
gtggcgctgctgacgcgcagccaccggttcggcgccgattcgggcatcggcgagctggcg
cggcgcgtcaacgccggggagggccgggcatcgctgctgacgctggacgatgcaaactgg
cccgacgtgtggcggcaggaggccgcttgcgatgccgatttgctggcgcggcggcgcggc
tatctggacgcggtggcggccggagcggatgccgacgaggtgcagcgcgctttttctgcc
ttcatgctgctggccgcagagcggcgccaggtggccgactgcaatcgccgcgtcgagcgc
gaactggaagccgcagggatcaagcaaccgggcagggactggtatccggggcggccggtg
atgataggcgagaacgactacggtttgagcttgttcaacggcgacatcggcttcgccttg
cagcggccgtccggcctgcgggtcctgttcccatccgcggacggcggctggcgcgaattc
tcccccggccggctgccggcgcacgagaccgtgttcgcgatgacggttcacaagagccag
ggctcggagtacgacgaagtgtggctgcagttgccgcagcaagccggcgcgctgctcaac
cgcgcgctgttgtacaccgccatcacccgcgcccgcctgcgtttcgcggcggtgggcgac
gccgatgtctggctgcggggggcggaactggcgccgcgccgggattccggcctgggcgac
cgattgcgttga

DBGET integrated database retrieval system