KEGG   Chromobacterium sp. IIBBL 274-1: DK843_20705Help
Entry
DK843_20705       CDS       T05744                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
chrb  Chromobacterium sp. IIBBL 274-1
Pathway
chrb00430  Taurine and hypotaurine metabolism
chrb00620  Pyruvate metabolism
chrb00640  Propanoate metabolism
chrb00680  Methane metabolism
chrb01100  Metabolic pathways
chrb01120  Microbial metabolism in diverse environments
chrb01200  Carbon metabolism
Module
chrb_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:chrb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DK843_20705
   00640 Propanoate metabolism
    DK843_20705
  09102 Energy metabolism
   00680 Methane metabolism
    DK843_20705
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    DK843_20705
Enzymes [BR:chrb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     DK843_20705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase ROK
Motif
Other DBs
NCBI-ProteinID: AXE37099
UniProt: A0A344UPA1
Position
complement(4333293..4334486)
Genome map
AA seq 397 aa AA seqDB search
MNSSILVINCGSSSLKFALIDSISHEAVMTGLAEKLGLSDACITFKHDGGKQTAQLSAPD
HAAAMHAIIEKLQQVSLLDTVKAIGHRVVHGGEHFKQSALLDEAAISEIERCIKLAPLHN
PAHILGMRTAIKEFPSLPQVAVFDTSFHQTMPEKAYLYAVPMKLYRENSLRRYGMHGTSY
RFVAEEAAKMLGKPAEETCLVIAHLGNGASISAIRDGKCADTSMGLTPLEGLVMGTRSGD
IDPSVFSYLAAERDMDIQAVTNMLNKESGLLGLSELSNDCRELEEAASKGHEGAKRALEV
FAYRLAKYVASMTVGAGRLDAVVFTGGIGENSSFLRGEVIKQLGFLGLKLDAAANEACTR
GNAGRITTADSVPALVINTNEELMIAMDTAELAGLAH
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaattccagcatcctcgtcatcaattgcggcagttcctccctgaaattcgcgctgatc
gacagcatcagccacgaagcagtcatgaccggcctggcggaaaagcttggcctgtccgac
gcttgcatcaccttcaagcacgacggcggcaagcaaaccgcgcagctgtccgctccggat
cacgccgccgccatgcacgccatcatcgagaagctgcagcaagtgtcgctgctggatacc
gtgaaggccatcggccaccgcgtggttcacggcggcgagcacttcaagcaatccgcgctg
ctggacgaagccgccatcagcgagatcgagcgctgcatcaagctggcgccgctgcacaac
ccggcccacattctgggcatgcgcaccgcgatcaaggagttcccgagcctgccgcaggtg
gccgtgttcgacacctccttccatcaaaccatgccggaaaaggcgtacctgtacgccgtg
ccgatgaagctgtaccgcgaaaacagcctgcgccgctacggcatgcacggcaccagctac
cgcttcgtggccgaagaagccgccaagatgctgggcaagccggctgaggaaacctgcctg
gtgatcgcccacctgggcaacggcgcgtccatctccgccatccgcgacggcaaatgcgcc
gatacctccatgggcctgaccccgctggaaggcctggtgatgggcacccgctccggcgac
atcgaccccagcgtattcagctacctggcggccgagcgcgacatggacatccaggccgtc
accaatatgctgaacaaggagtccggcctgctgggcctgtccgagctgtccaacgactgc
cgcgagctggaagaggccgcctccaagggccacgaaggcgccaaacgcgcgctggaagtg
ttcgcctaccgcctggccaagtacgtggcctccatgaccgtgggcgccggccgcctggac
gccgtggtgttcaccggcggcatcggcgagaactcgtccttcctgcgcggcgaagtcatc
aagcaactgggcttcctgggcctgaagctcgatgccgccgccaacgaagcctgcacccgc
ggcaacgccggccgcatcactaccgccgactccgtgccggcgctggtgatcaacaccaac
gaagaactgatgatcgccatggacaccgccgaactggcgggcctggcgcactga

DBGET integrated database retrieval system