KEGG   Chryseoglobus sp. 28M-23: IE160_02990
Entry
IE160_02990       CDS       T06824                                 

Definition
(GenBank) mycofactocin-coupled SDR family oxidoreductase
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
chre  Chryseoglobus sp. 28M-23
Pathway
chre00903  Limonene and pinene degradation
chre01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:chre00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    IE160_02990
Enzymes [BR:chre01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     IE160_02990
SSDB
Motif
Pfam: adh_short_C2 adh_short KR DUF1776
Other DBs
NCBI-ProteinID: QOD94214
Position
complement(607922..608755)
AA seq 277 aa
MGRLDGKVVFITGVARGQGRSHAIRFAEEGADIIGIDVLEPIAGSVSDPTTQADMEETVA
AVEALDRRIIATKADVRSLEQVKKAVDDGVAELGRLDVVLANAGVSTFTGPTESLSEEAF
TDLVDINLNGVWRTCAAAIPHIKTGERGGSIIMTSSAAGLTALANLGHYVAAKHGVVGLM
RALALELAPHKIRVNSIHPTTVDTPMVNNEATFKLFRPDLDKPGVDDFLEAAKVMNALPV
GWVQSVDISNAMVWLASDEARYVTGVTLPVDAGMLVK
NT seq 834 nt   +upstreamnt  +downstreamnt
atggggcgtttagatggaaaagtggttttcatcacgggtgtcgcccgggggcagggtcgc
agtcacgcgatccggttcgccgaggaaggcgccgacatcatcggtatcgacgtgctcgaa
ccgattgccgggtctgtgtccgaccccacgacgcaggccgatatggaggagactgtcgcc
gcggtcgaagctctcgatcggcgcatcatcgcgacgaaggccgacgtgcgcagcctggag
caagtcaagaaagcggtggatgacggggtcgccgagcttgggcgactcgatgtcgtcctg
gcgaacgcgggagtgtcgacgtttacggggccgacagaatcgttgagcgaggaggcattc
acggatctcgtggatatcaacctcaacggcgtctggcgcacgtgcgccgcggctatccct
catatcaagactggtgagcgtggcggatcgatcatcatgacgagttccgctgctggacta
acggccctggcaaacctcggccactatgtcgcggcgaaacatggtgtcgtcggcctcatg
cgagcgctcgctctcgagctggcccctcacaagatcagggtcaattccatccatccgaca
acggtggacactcccatggtcaacaacgaggccacgttcaagctcttccggcccgatctc
gacaagcccggcgttgacgacttcctcgaggcggccaaggtcatgaatgctctgcccgtg
ggctgggttcagtctgtcgacatctcgaacgcgatggtctggctcgcctcggacgaagcg
cgctacgtcacaggcgtcacgttgcccgtcgatgccggaatgctcgtcaagtag

DBGET integrated database retrieval system