KEGG   Chromobacterium sp. IIBBL 112-1: DK842_00790Help
Entry
DK842_00790       CDS       T05549                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
chri  Chromobacterium sp. IIBBL 112-1
Pathway
chri00360  Phenylalanine metabolism
chri00400  Phenylalanine, tyrosine and tryptophan biosynthesis
chri00790  Folate biosynthesis
chri01100  Metabolic pathways
chri01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:chri00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    DK842_00790
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DK842_00790
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DK842_00790
Enzymes [BR:chri01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     DK842_00790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AXE28587
Position
complement(161611..162504)
Genome map
AA seq 297 aa AA seqDB search
MNDRADFVVPDITTRKNVGLSHDANDYTLPQPLERYTAEDHATWATLYARQSKLLPGRAC
DEFLQGLRDLEVDHDRVPDFEKLNEKLMAATGWRIVAVPGLIPDDVFFEHLANRRFPVTW
WLREPHQLDYLQEPDVFHDLFGHVPLLINPVFADYLEAYGKGGIKAKALGALPMLARLYW
YTVEFGLINTPAGMRIYGAGIVSSKSESIYCLDSASPNRVGFDLMRIMNTRYRIDTFQKT
YFVIDSFKQLFDATAPDFAPLYRELADSAPWGAGDIAPSDVVINEGDRQGWAETDDV
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaccgcgccgactttgtggtgcccgacatcaccacgcgcaagaatgtcggattg
agccacgacgccaacgactacactttgccgcagccgctggagcgctacaccgcggaagac
cacgccacctgggccacgctgtatgctcgccagagcaagctgttgccgggccgcgcctgc
gacgagttcctgcagggcctgcgcgatctggaagtggaccatgatcgggtgccggatttc
gagaagctcaacgagaagctgatggccgccaccggctggcggatcgtcgcggtgccgggg
ctgattcccgacgacgtgttcttcgagcatctggccaaccgccgcttcccggtcacctgg
tggctgcgcgagccgcaccagctggattacctgcaggagccggacgtgttccacgacctg
ttcggccacgtgccgctgctgatcaacccggtgttcgccgactatctggaggcctacggc
aaaggcggcatcaaggccaaggcgctgggcgcgctgcctatgctggcgcggctgtactgg
tacacggtggagttcggcctgatcaatacgccggccggcatgcgcatctacggcgcaggc
atcgtgtccagcaagtccgagtccatctattgcctggacagcgccagtcccaaccgcgtt
ggctttgacctgatgcgcatcatgaacacgcgctaccggatcgacaccttccagaagact
tacttcgtcatcgacagcttcaagcagttgtttgacgccaccgcgccggatttcgcgccc
ctgtaccgcgaattggccgacagcgcgccgtggggcgctggcgacatcgcgccgagcgac
gtggtgatcaacgagggagatcgccagggctgggcggagaccgacgacgtttga

DBGET integrated database retrieval system