KEGG   Chromobacterium sp. IIBBL 112-1: DK842_01375Help
Entry
DK842_01375       CDS       T05549                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
chri  Chromobacterium sp. IIBBL 112-1
Pathway
chri00620  Pyruvate metabolism
chri00630  Glyoxylate and dicarboxylate metabolism
chri01100  Metabolic pathways
chri01110  Biosynthesis of secondary metabolites
chri01120  Microbial metabolism in diverse environments
chri01200  Carbon metabolism
Module
chri_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:chri00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DK842_01375
   00630 Glyoxylate and dicarboxylate metabolism
    DK842_01375
Enzymes [BR:chri01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     DK842_01375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AXE28685
Position
271793..273388
Genome map
AA seq 531 aa AA seqDB search
MAVNLPQGVEVLADITPAYAEILTPEALAFVAKLHRRFEPTRRERIAARAARQAELDAGK
LPDFLPETAAVRAGGWKIAPLPQDLLDRRVEITGPVERKMMINALNSGAKSFMADFEDSN
CPSWDNQIAGQINVRDAYRKTISFQSPEGKQYRLNDTIATLLLRPRGWHLMEKHVKVDGE
IVSGSLFDFGLSFFHNIHYLRENGSATYYYLPKMESHLEARLWNDVFAFAQNELNVPQGT
IKATVLIETILAAFEMDEILYELREHSAGLNAGRWDYIFSCIKKFKQNRDFCLANRALIT
MTVPFMRAYALLLLKTCHHRDAPAIGGMAALIPIKNDAAANDKALAGVKADKDRDATDGY
DGGWVAHPGLVPIAAAAFGAVLGDAPNQIAKQRPDVQVSAADLLNFQPEAPITEAGLAMN
INVGIQYLGSWISGNGCVPIHNLMEDAATAEISRSQIWQWIRSPKGVLDDGRKVTVELFR
ELQAREVAKLQAEYGARWTRQYEDAAKMFDLLTTSDDFVEFLTLPGYEYIA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcaatctcccgcagggcgtggaagttctcgccgacatcactccggcctacgcc
gaaatcctcactcccgaggcgctggccttcgtcgccaagctgcaccgccgcttcgagccg
acacgccgcgagcgcatcgccgcccgcgccgcgcgccaggccgagctggacgccggcaag
ctgccggacttcctgccggaaaccgccgccgtgcgcgccggcggctggaagatcgcgccg
ctgccgcaggacctgctggaccgccgcgtggaaatcaccggcccggtagagcgcaagatg
atgatcaacgcgctgaattccggcgccaagagcttcatggccgacttcgaggactccaac
tgcccgagctgggacaaccagatcgccggccagatcaatgtccgcgacgcctaccgcaag
accatttccttccaaagcccggaaggcaagcaataccggctgaacgacaccatcgccacc
ctgctgctacgcccgcgcggctggcacctgatggaaaagcacgtcaaggtggacggcgag
atcgtgtccggcagcctgttcgacttcggcctgtccttcttccacaacatccattacctg
cgcgaaaacggcagcgccacctattactacctgcccaagatggaaagccatctggaagcg
cgcctgtggaacgacgtcttcgcgttcgcccagaacgagctgaacgtcccgcaaggcacg
atcaaggccaccgtgctgatcgagaccatcctcgccgccttcgagatggacgaaatcctc
tacgagctgcgtgagcactccgccggcctcaacgccggccgctgggactacatcttcagc
tgcatcaagaaattcaagcagaaccgcgacttctgcctggccaaccgcgcgctgatcacc
atgaccgtgcccttcatgcgcgcctacgcgctgttgctgctgaaaacctgccaccaccgc
gacgcgccggccatcggcggcatggcggcgctgattccgatcaagaacgacgcagccgcc
aatgacaaggcgctggccggcgtcaaggcggacaaggaccgcgacgccaccgacggctac
gacggcggctgggtggcccaccccggcctggtgcccatcgccgccgcggctttcggcgcc
gtgctgggcgacgcgccgaaccagatcgccaagcagcgcccggacgtgcaggtttccgcc
gccgatctgctgaacttccagccggaagcgccgatcaccgaagccggcctggccatgaac
atcaacgtcggcatccagtacctgggttcctggatttccggcaacggctgcgtgcccatc
cacaacctgatggaagacgccgccaccgccgagatctcgcgttcgcagatctggcagtgg
atacgctcgcccaagggcgtgctggacgatggccgcaaggtgacggttgagctgttccgc
gagctgcaggcccgcgaagtggccaaactgcaagccgaatacggcgcgcgctggacccgg
caatacgaagacgcggccaagatgttcgatcttctgactacgtctgatgacttcgtcgaa
ttcctgacgctgccgggctacgaatacatcgcctga

DBGET integrated database retrieval system