KEGG   Chromobacterium sp. IIBBL 112-1: DK842_02760Help
Entry
DK842_02760       CDS       T05549                                 

Definition
(GenBank) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
chri  Chromobacterium sp. IIBBL 112-1
Pathway
chri00330  Arginine and proline metabolism
chri00360  Phenylalanine metabolism
chri00380  Tryptophan metabolism
chri00627  Aminobenzoate degradation
chri00643  Styrene degradation
chri01100  Metabolic pathways
chri01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:chri00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    DK842_02760
   00360 Phenylalanine metabolism
    DK842_02760
   00380 Tryptophan metabolism
    DK842_02760
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    DK842_02760
   00643 Styrene degradation
    DK842_02760
Enzymes [BR:chri01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     DK842_02760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AXE28924
Position
561195..562595
Genome map
AA seq 466 aa AA seqDB search
MTDIDTLSLREMADLQQRGRLASRDLAEHYLARIAERNPQLNAIIEQAPPQRVLAEADAA
DAALRRGRPQGPLHGVPLSLKDACHVRGFHPSRGVRELHGAASEANATVVQRLFDAGAIA
LGLSNVPEMCMAFDTDNLLYGRTLNPHDPERSAGGSSGGEASAIAAGMSPGGLASDACGS
VRVPAHFNGVCGLKLTQWRAPLTGQFPHDRSGLFHLSSSFAVMGRGVDDIALLGQLISGP
DGKDPDTVPAPFRDYREQPLSALRIGVWQESAGPARPSAATSALLQHAAALLDGAAASVA
EVVPPMVDEAFDALWKVLVLGGDGGRGWKQLFSRMGKTAFSAPIAQLLEWSGELEMSVDE
LRASLVMRDTVRHRLAMMFRDIDVLICPVYPDIAFRHGESLREPGAYRYVFPFSLSGSPA
AVIPAGRCPDSGMPIGLQLVGRHWDEHQLLAAAAHLERLLPAWRPV
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgacagacatcgacaccctgagcctgagggagatggccgacctgcagcagcgcggccgc
ttggccagccgcgacctggccgagcactacctggcgcgcatcgccgagcgcaatccccag
ctgaacgcaatcatcgagcaggcgcccccgcaacgcgtgctggccgaggctgacgccgcc
gacgccgcgctgcggcgcggccgcccccagggaccgttgcacggcgtgccgctcagcttg
aaggatgcctgccacgtccgcggcttccaccccagccgcggcgtgcgcgagctccacggc
gcggccagcgaagccaacgccaccgtggtccagcgattattcgacgccggcgccatcgcc
ctcggcctcagcaatgtgccggaaatgtgcatggccttcgataccgacaacctgctgtac
ggccgcacgctcaatccgcacgatccagagcgctccgccggcggaagcagcggcggcgag
gcctcggccatcgccgccggcatgagcccgggcgggctggcgtccgacgcctgcggcagc
gtgcgcgtgcccgcccacttcaacggcgtgtgcgggctgaagctgacgcaatggcgcgcg
ccgctgaccggccagttcccgcacgaccgctccggcctgttccacctcagctcctcgttc
gcggtgatggggcgcggcgtcgacgacatcgcgctgctgggccagctgatcagcggcccg
gacggcaaggacccggacaccgtgccggcgccgttccgcgactaccgcgagcagccgctg
tccgcgctgcgcatcggcgtctggcaggaaagcgccggcccggcccggccctccgcggcc
acgtccgcgctgctgcagcatgctgcggcgctgctggacggcgccgcagcgtcagtggct
gaagtcgtcccgccgatggttgacgaggcttttgatgctttatggaaagtgctggtgctg
ggcggcgacggcggccgcggctggaagcaactcttcagccggatgggaaaaaccgcgttc
tccgcgcccatcgcccaactgctggagtggagcggcgaactggaaatgagcgtggacgag
ctgcgcgcgtcgctggtgatgcgggacacggttcgccaccggctggccatgatgttccgc
gacatcgacgtgctgatctgcccggtctatccggacatcgccttccgccacggcgaatcg
ctgcgcgagccgggcgcctaccgctacgtcttcccgttcagcctcagcggttcgccggcg
gcggtgattccggccggccgctgcccggacagcggcatgccgatcgggctgcaactggtg
ggacgccattgggacgagcaccagttgctggccgcggcggctcacctggagcgactgctg
ccggcctggcgtccggtttag

DBGET integrated database retrieval system