KEGG   Chromobacterium sp. IIBBL 112-1: DK842_03315Help
Entry
DK842_03315       CDS       T05549                                 

Gene name
hemN
Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
chri  Chromobacterium sp. IIBBL 112-1
Pathway
chri00860  Porphyrin and chlorophyll metabolism
chri01100  Metabolic pathways
chri01110  Biosynthesis of secondary metabolites
Module
chri_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:chri00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DK842_03315 (hemN)
Enzymes [BR:chri01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     DK842_03315 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C GrpE
Motif
Other DBs
NCBI-ProteinID: AXE29025
Position
660563..661969
Genome map
AA seq 468 aa AA seqDB search
MKTTHPFSPAHFVFDRELIERLDGAGPRYTSYPTADRFTSKFSEEDYLNKLRQRQIGANR
RPLSLYAHIPFCNTICYYCACNKIITKDSAKADQYLDYLEKEIRLVSEALGIREKVIQLH
FGGGTPTFLSDAQLERLMGILGTHFEFLSDGEYSIEIDPRKVKRETMLKLAGYGFNRVSV
GIQDFDPAVQKAVNRVQSEEETRAVIEAAREGGFKSVSLDLIYGLPLQTRETMRDTLQKA
LALDPDRLSLYNYAHLPSVFMPQRRIHEADLPGAAVKLDILQDAVKTLTDAGYVFIGMDH
FAKPDDELAVALRQGRLQRNFQGYSTHADCDMLAFGVSAIGKVGSCYSQNDKSLEGYYAA
LDQGRLPVVRGLTLNNDDILRRTIIQGLMCRFALSVEAIEEIHGINFAQYFAEEMPRIRE
FQQQGLLSFDGDFLMVEPQGRFLIRNIAMIFDRHLRERETHARYSKTI
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactacccaccccttctctcccgcccatttcgtcttcgatcgcgagctgatcgag
aggctggatggcgcggggccaagatacacctcttatccgacagctgatcgctttacatca
aagttttcggaagaagattatctgaacaaactgcggcagcgtcagattggcgccaaccgc
agacctttatcattgtacgctcatataccgttttgcaacacaatttgttattactgcgcc
tgcaacaagatcatcaccaaagacagcgccaaagcggatcagtatttggattacctggag
aaagaaatccggttggtgagcgaagcgctgggcatccgtgaaaaagtgatacagcttcac
tttggcggcggcactccgaccttcttgtccgatgcgcaacttgaacggctgatgggcata
ctcggcacgcactttgaattcctaagcgacggagagtattccatagagatagacccgcgc
aaggtaaaacgcgaaaccatgctcaagctggcaggatatggcttcaatcgcgtcagcgtg
gggatacaagatttcgacccggcagtacagaaagcggtcaaccgggtgcaaagcgaggag
gaaacccgggcggtgatcgaggcggcgcgcgaaggcggcttcaaatcggtcagcctggac
ctgatctacggcctaccgctgcaaactcgcgaaacgatgcgcgacacgctgcaaaaggcg
ctggcgctcgacccggaccgcttgtcgctgtacaactacgcccacctgcccagcgtgttc
atgccgcagcgccgcatccacgaggccgacctgccgggagcggcggtcaagctggacatc
ttgcaagacgcggtgaagaccttgaccgacgccggctacgtgttcatcggcatggaccat
ttcgccaagcccgacgacgaactggccgtggccctgcgccagggccggctgcagcgcaac
ttccagggctactccacccacgccgactgcgacatgctggccttcggcgtatccgccatc
ggcaaggtgggctcctgttacagccagaacgacaagtcgctggagggttactacgcggcg
ctcgaccagggccggctgccggtggtacgcggactgacgctgaacaacgacgacatcctg
cgccgcaccatcatccaggggctgatgtgccgattcgccttgtcggtggaagcgatagag
gaaatccacggcatcaatttcgcccagtacttcgccgaggaaatgccccgcatccgcgaa
ttccagcagcaaggcctgctgtccttcgacggtgacttcctgatggtggagccccagggc
cgcttcctgatccgcaacatcgccatgatcttcgaccgccacctgcgcgagcgcgaaacc
cacgcccgctactccaaaaccatctga

DBGET integrated database retrieval system