KEGG   Chromobacterium sp. IIBBL 112-1: DK842_06830Help
Entry
DK842_06830       CDS       T05549                                 

Definition
(GenBank) histidine phosphatase family protein
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
chri  Chromobacterium sp. IIBBL 112-1
Pathway
chri00860  Porphyrin and chlorophyll metabolism
chri01100  Metabolic pathways
Module
chri_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:chri00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DK842_06830
Enzymes [BR:chri01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     DK842_06830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AXE29638
Position
1446509..1447111
Genome map
AA seq 200 aa AA seqDB search
MNPYTLTLLRHGDIPHDGRLIGLTDLPLTELGHQQLEHSWKRISNLAPVTCIATSPLQRC
REFAVKQALAGSLTLKVDPRFAEMDFGGWDGQPVADLEREHPGWGADLANGRLSPPGGES
FEQFRTRALAGLADWMTEARGSHRLLITHGGVITVLMAELLGTEFSVAKLMTVQRGGFVQ
LSMLEGHPAYLLRLESACAD
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaacccttacaccctgaccctgctgcgccatggcgacattccgcacgacggccggctg
atcggcctgaccgacctgccgctgaccgaactgggccaccagcagctggaacatagctgg
aaacgcatcagcaacctggcgccggtcacctgcatcgccacctcgccgctgcagcgctgc
cgcgagttcgcggtcaagcaggcgctggccggctcgctgacgctgaaagtggacccgcgc
ttcgccgagatggacttcggcggctgggacggccagccggtggccgatctggagcgggag
caccccggctggggcgcggacctggcaaacggcaggctgtccccgcccggcggcgaaagc
ttcgagcaattccgcacccgcgcgctggccggcctggccgactggatgaccgaagcccga
ggcagccaccggctgctgatcactcatggcggcgtgatcacggtgctgatggccgagttg
ctgggcaccgaattttcggtggccaagctgatgacggtgcagcgcggcggcttcgtacag
ctgtcgatgctggaaggacatccggcctacctgctgcgcctggagtccgcatgcgcggac
tga

DBGET integrated database retrieval system