KEGG   Chromobacterium sp. IIBBL 112-1: DK842_10470Help
Entry
DK842_10470       CDS       T05549                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
chri  Chromobacterium sp. IIBBL 112-1
Pathway
chri03010  Ribosome
Brite
KEGG Orthology (KO) [BR:chri00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DK842_10470
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:chri03011]
    DK842_10470
Ribosome [BR:chri03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    DK842_10470
  Bacteria
    DK842_10470
  Archaea
    DK842_10470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 PAS_10
Motif
Other DBs
NCBI-ProteinID: AXE30290
Position
2211699..2212028
Genome map
AA seq 109 aa AA seqDB search
MRVSANLKSVRLSAQKCRLVADLVRGKSVDQALNILAFSPKKGAVIIKKVLESAIANAEH
NEGADIDTLRVTSIFVDKGASLKRFTARAKGRGNRIEKQTCHISLTVGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgagagtatctgcaaatctgaaaagtgttcgcctgtcggctcaaaagtgccgcctggta
gcggacctggttcgcggcaagtccgtcgatcaggcgctgaatatcctggccttctccccg
aaaaagggtgcggtcatcatcaagaaagtgctggaatctgccatcgctaacgccgagcac
aacgaaggcgctgacatcgacaccctgcgtgtcaccagcatctttgttgacaagggcgct
agtctgaagcgtttcactgcccgtgctaagggtcgtggcaatcgcatcgaaaagcagacc
tgccacatttccttgaccgttggcaattaa

DBGET integrated database retrieval system