KEGG   Chromobacterium sp. IIBBL 112-1: DK842_16545Help
Entry
DK842_16545       CDS       T05549                                 

Definition
(GenBank) aldehyde dehydrogenase (NADP(+))
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
chri  Chromobacterium sp. IIBBL 112-1
Pathway
chri00040  Pentose and glucuronate interconversions
chri00053  Ascorbate and aldarate metabolism
chri01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chri00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DK842_16545
   00053 Ascorbate and aldarate metabolism
    DK842_16545
Enzymes [BR:chri01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     DK842_16545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AXE31367
Position
3495986..3497557
Genome map
AA seq 523 aa AA seqDB search
MNLTGMMLIGGQAVAGRRERIRAIDPSTDQPLEPGYPGADREQVEQACALAWEAFDAYRE
TALETRARFLETIADELEALGDALIERAMAETGLPRARLQGERGRTCGQLRLFARTLRAG
EWLDARVDPAMPQRQPLPRADLRQRQVALGPVAVFGASNFPLAFSVAGGDTASALAAGCP
VIVKAHSAHPGVSELAGRAIARAAEKCGLPAGVFALLFGDGREAGQALVADPRIKAVGFT
GSRGGGLALCRLAQSRPEPIPVFAEMSSTNPVFLLPAALRARGEALAQGFIGSLTLGAGQ
FCTNPGLIIAEQGPALDGFIAAASALLRQSPAQTMLTPGIFRAYQAGVDALSGHARLVAA
GLPATGPNQCQAQLWLADARDYLANPVLRAEVFGAAALIVRCRDAGEFRQLAEQLEGQLT
ATLQLDDGDLDLAHALLPTLERKAGRILVNGWPTGVDVCDAMVHGGPYPATSDARATSVG
TAAIQRFLRPVCYQDLPDALLPQALKHANPLALRRLLDGGREG
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgacaggcatgatgcttatcggcgggcaggctgttgccggccgccgcgagagg
atacgggcgatagacccgtccaccgatcagccgctggagccgggctaccccggcgcggac
cgcgaacaggtggagcaggcctgcgccttggcctgggaggcgtttgacgcctaccgcgaa
accgcgctggaaacgcgggcgcgctttctcgaaaccatcgccgacgagttggaagcgttg
ggtgatgcgctgatagaacgcgccatggccgaaactggcctgccgcgcgcccgcttgcaa
ggggagcgcggccgcacctgcggccagctgcggctgttcgcccgcacgctgcgggccggt
gagtggctggacgcgcgggtagacccggccatgccgcagcgccagccgctgccgcgcgcc
gatctgcgccagcgccaggtggcattggggccggtggcggtgttcggcgccagcaatttc
cccctggccttctcggtggccggcggcgacaccgcttccgcgctggcggccggctgcccg
gtcatcgtcaaggcccacagcgctcatcccggcgtcagcgagctggcggggcgggccatc
gcacgggcggcggagaaatgcgggctgccggccggcgtgttcgcgctgctgttcggcgac
ggccgcgaagcggggcaggcgctggtggccgatccgcgcatcaaggcggtgggcttcacc
ggctcgcgcggcggcggcctggccttgtgccggctggcgcaaagccggccggagccaatt
ccggtgttcgcggaaatgagctccaccaatccggtgtttctgctgccggctgcgctgcgg
gcgcgcggtgaggcgctggcgcagggcttcatcggctcgctgacgctgggcgcggggcag
ttctgcaccaatcccggcttgatcatcgccgagcagggcccggcgctggacggtttcatc
gccgccgcgtccgcgctgctgcggcagagcccggcgcagaccatgctgacgcccggcatc
ttccgcgcttaccaggccggtgtggacgcgctgtccggccatgctcgcctggtggccgcc
ggcttgccagccaccgggccgaaccagtgccaggcccagctgtggctggccgacgcgcgg
gattacctggccaatccggtgttgcgggccgaggtgttcggcgcggccgccctgatcgtg
cgatgccgggacgcgggtgaattccgccaacttgccgagcaactggaaggccagctcacc
gccacgttgcagctggacgacggcgatctggacctggcccacgcgttgctgcccacgctg
gagcgcaaggccggccgcattctggtcaacggctggcccaccggcgtggatgtgtgcgac
gccatggtgcatggcgggccgtacccggccacctcggacgcgcgggccacctcggtgggt
accgcggctatccagcgcttcctgcggccggtgtgctaccaggacttgccggacgcgctg
ctgccgcaggcattgaaacacgccaatccgctggcgctacgccgcctgctggacggcggg
cgggagggctga

DBGET integrated database retrieval system