KEGG   Chromobacterium sp. IIBBL 112-1: DK842_17700Help
Entry
DK842_17700       CDS       T05549                                 

Gene name
trpD
Definition
(GenBank) anthranilate phosphoribosyltransferase
  KO
K00766  anthranilate phosphoribosyltransferase [EC:2.4.2.18]
Organism
chri  Chromobacterium sp. IIBBL 112-1
Pathway
chri00400  Phenylalanine, tyrosine and tryptophan biosynthesis
chri01100  Metabolic pathways
chri01110  Biosynthesis of secondary metabolites
chri01130  Biosynthesis of antibiotics
chri01230  Biosynthesis of amino acids
Module
chri_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:chri00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DK842_17700 (trpD)
Enzymes [BR:chri01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     DK842_17700 (trpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N REPA_OB_2
Motif
Other DBs
NCBI-ProteinID: AXE31573
Position
complement(3752563..3753591)
Genome map
AA seq 342 aa AA seqDB search
MISPQAALNRLIDGNELFYEEMLALMRQIMRGELTQAQTAAILIGLRVKVESVSEIAAAA
TVMREFATHVPVADRRHLVDTCGTGGDKSHTFNISTTASFVAAAAGARVAKHGGRSVSSS
SGSADVLERLGVNLQLAPEQVGQCLDEIGLGFMFAPNHHSAMKHVAPIRKELGARTIFNI
LGPLTNPAGADNQLMGVFHPDLVGIQSRVLKQLGSKHVMIVHGSDGLDELTLSGSSMVAE
LKNGEILEYELEPGEFGLAECELKALRATTAEQSRDRLLSVLDGESGPARDIVLFNAGAA
IYTADIAPSLADGVTMAREALDSGKAKLKLQQLIALSQKLGA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgatctccccgcaagcggcattgaaccgcctgatcgacggcaacgaactgttttacgaa
gaaatgctggcgctgatgcgccagatcatgcgcggcgaactgactcaggcccagaccgcc
gccatcctgatcggcttgcgggtcaaggtggaatcggtatcggaaatcgccgccgccgcc
accgtgatgcgcgaattcgccacccacgtgccagtggccgatcgccgccatctggtcgat
acctgcggcaccggcggcgacaaatcgcacaccttcaacatctccaccaccgcctccttt
gtcgccgcggcggcgggcgcgcgcgtggccaagcacggcggccgctcggtgtcgtccagc
tccggcagcgccgacgtgctggagcggctcggcgtcaatctgcagctggcgccggagcag
gtggggcaatgcctggacgaaatcggcctgggcttcatgttcgcgcccaaccaccacagc
gcgatgaagcacgtggcgccgatacgcaaggagctgggcgcgcgcaccatcttcaacatc
ctgggcccgctgaccaacccggccggcgccgacaaccagctgatgggcgtgttccacccc
gaccttgtgggcatccagtcgcgcgtgctcaagcaactgggcagcaagcacgtgatgatc
gtccatggcagcgacggcctggacgaattgacactatccggctccagcatggtggcggag
ctcaagaacggcgagatactggaatacgaactggagccgggcgagttcgggctcgcggaa
tgcgagctgaaagcgctgcgcgccaccaccgcggaacaatccagggaccgcctgctgtcc
gtgctggacggcgagagcggccccgcccgcgacatcgtgctgttcaacgccggcgcggcg
atttacaccgccgacatcgccccaagcctggctgacggtgttaccatggcgcgcgaggcc
ttggacagcggcaaggccaagctgaaactgcagcaactgatcgccttgagccagaagctc
ggcgcctga

DBGET integrated database retrieval system