KEGG   Chromobacterium sp. IIBBL 112-1: DK842_18235Help
Entry
DK842_18235       CDS       T05549                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
chri  Chromobacterium sp. IIBBL 112-1
Brite
KEGG Orthology (KO) [BR:chri00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    DK842_18235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 YidC_periplas DUF4354
Motif
Other DBs
NCBI-ProteinID: AXE31669
Position
3826798..3827178
Genome map
AA seq 126 aa AA seqDB search
MADKLYQMEVMAEPQYVAEQSSVANDVYVFAYRVRITNTGSEPAQLVSRHWIITDANQQV
QEVRGMGVVGEQPHLDPGQVFEYSSAAHICTPYGSMKGAYQMVADDGRRFEASIPEMTLV
APRVLH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggccgataaactctaccagatggaggtgatggcggagccgcaatacgtggccgagcag
tccagcgtcgccaacgacgtctacgtgttcgcctatcgggtccgcatcaccaataccggc
agcgagccggcgcagctggtcagccgccactggatcatcaccgacgccaaccagcaagtg
caggaagtgcgcggcatgggggtggtgggcgagcagccgcatctggacccgggccaggtg
ttcgaatactccagcgccgcccatatctgcacgccttacggcagcatgaagggggcttat
cagatggtggcggacgacggccgccgttttgaggcgtccattccggaaatgacgctggtg
gcgccgcgggtgctgcactag

DBGET integrated database retrieval system