KEGG   Chromobacterium sp. 257-1: FYK34_00205Help
Entry
FYK34_00205       CDS       T06224                                 

Gene name
groL
Definition
(GenBank) chaperonin GroEL
  KO
K04077  chaperonin GroEL
Organism
chrm  Chromobacterium sp. 257-1
Pathway
chrm03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:chrm00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    FYK34_00205 (groL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:chrm03019]
    FYK34_00205 (groL)
   03110 Chaperones and folding catalysts [BR:chrm03110]
    FYK34_00205 (groL)
   03029 Mitochondrial biogenesis [BR:chrm03029]
    FYK34_00205 (groL)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chrm04147]
    FYK34_00205 (groL)
Messenger RNA biogenesis [BR:chrm03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     FYK34_00205 (groL)
Chaperones and folding catalysts [BR:chrm03110]
 Heat shock proteins
  HSP60 / Chaperonin
   FYK34_00205 (groL)
Mitochondrial biogenesis [BR:chrm03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    FYK34_00205 (groL)
Exosome [BR:chrm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   FYK34_00205 (groL)
  Exosomal proteins of other body fluids (saliva and urine)
   FYK34_00205 (groL)
  Exosomal proteins of breast cancer cells
   FYK34_00205 (groL)
  Exosomal proteins of colorectal cancer cells
   FYK34_00205 (groL)
  Exosomal proteins of bladder cancer cells
   FYK34_00205 (groL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cpn60_TCP1
Motif
Other DBs
NCBI-ProteinID: QEL54114
UniProt: A0A5C1DBW1
Position
complement(37211..38827)
Genome map
AA seq 538 aa AA seqDB search
MAAKEVRFHDNARERIVNGVNVLANAVKVTLGPKGRNVLLARSFGAPHITKDGVSVAKEI
ELKDPFENMGAQMVKEVASKTADVAGDGTTTATVLAQAIVQEGMKYVAAGMNPMDLKRGI
DKAVHAVVKELQTLSKPVTNSKETAQVAALSANSDEAIGKIIADAMDKVGKEGVITVEDG
KSLDNELAVVEGMQFDRGYLSPYFITDPEKQTAVLEDPLVLLYDKKISNIRDLLPVLEQV
AKAGKPLLIVAEDVEGEALATLVVNSMRGILKVAAVKAPGFGDRRKAMLEDIAILTGGTV
IAEETGLTLEKAGLAELGSAKRVEIGKENTTIIDGAGDKAKIDARVQAIRAQIDAATSDY
DREKLQERVAKLSGGVAVIRIGAATEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALL
RARAHIGELKGDNADQDAGIQIVLRALEAPLRAIAANAGDEPSVIVNKVLEGKGSHGYNA
ASGQFGDLVEMGVIDPTKVTRTALQNAASIASLILTTDATVAEAAQDSKAKAPAELDY
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgaaagaagtccgcttccacgacaacgcccgtgaacgcatcgtcaacggcgtc
aatgtgctggccaacgcggtgaaagtcaccctgggcccgaaaggccgcaatgtgctgctg
gcgcgcagcttcggcgcgccgcacatcaccaaggacggcgtgtccgtcgccaaggaaatc
gaactgaaagacccgttcgaaaacatgggcgcgcagatggtgaaggaagtggcgtccaag
accgccgacgtggcgggcgacggcaccaccaccgccaccgtgctggctcaggccatcgtg
caggaaggcatgaaatacgtggccgccggcatgaacccgatggacctgaagcggggcatc
gacaaggccgtccatgcggtggtcaaggagctgcagaccctgtccaagccggtgaccaac
agcaaggaaaccgcccaggtggcggcgctatcggccaattccgacgaggccatcggcaag
atcatcgccgacgccatggataaggtgggcaaggaaggcgtgatcaccgtcgaggacggc
aagtccttggacaacgagctggccgtggtcgagggcatgcagttcgaccgcggctacctg
tcgccctacttcatcaccgatccggaaaagcaaaccgccgtgctggaagatccgctggtg
ctgctctacgacaagaagatcagcaatatccgcgacctgctgccggtgctggagcaagtg
gccaaggccggcaagccgttgctgatcgtcgccgaagacgtggaaggcgaagcgctggcc
accctggtggtgaacagcatgcgcggcatcctgaaggtggccgcggtcaaggcgccgggc
ttcggcgaccgccgcaaggccatgctggaagacatcgccatcctgaccggcggcaccgtc
atcgccgaggaaaccggcctcacgctggaaaaagccggcctggccgagctgggcagcgcc
aagcgcgtggaaatcggcaaggaaaacaccaccatcatcgacggcgccggcgacaaggcc
aagatcgacgcccgcgtgcaggccatccgggcgcagatcgacgccgccaccagcgactat
gaccgcgagaagctgcaagagcgcgtggccaagctgtccggcggcgtggcggtgatccgc
atcggcgcggccaccgaggtggaaatgaaagagaagaaagaccgcgtagacgacgcgctg
cacgccacccgcgccgcggtggaggaaggcatcgtggcaggcggcggcgtggccctgctg
cgcgcccgcgcccacatcggcgagctgaaaggcgacaacgccgaccaggacgccggcatc
cagatcgtgctgcgcgcgctggaagcgccgctgcgcgccatcgccgccaatgccggcgac
gagccgtcggtcatcgtcaacaaggtgctggagggcaaaggcagccatggctacaacgcc
gccagcggccagttcggcgatctggtggaaatgggcgtgatcgacccgaccaaggtgacg
cgcaccgcgctgcaaaacgccgcttccatcgccagcctgatcctgaccaccgacgccacc
gtggccgaggcggcgcaggacagcaaggccaaagccccggcggagctggattactga

DBGET integrated database retrieval system