KEGG   Chromobacterium sp. ATCC 53434: CXB49_02345Help
Entry
CXB49_02345       CDS       T05234                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
chro  Chromobacterium sp. ATCC 53434
Pathway
chro00480  Glutathione metabolism
chro00590  Arachidonic acid metabolism
chro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    CXB49_02345
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CXB49_02345
Enzymes [BR:chro01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CXB49_02345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AUH49756
UniProt: A0A2H5DRR5
Position
540267..540746
Genome map
AA seq 159 aa AA seqDB search
MTTLYDFSAQRADGALQAFSAYEGTVALLVNTASECGYTRQYAGLQELQDYFAGQAFAVL
GFPCNQFGGQEPGSEQEILAFCQGRFGVSFPLFAKLEVNGAGADPLWRWLTQADSPHPHP
VKWNFTKFLIDARGRVVKRYEPAVEPHELVEDIKALLAG
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgctctacgattttagcgcgcagcgggccgacggggccttgcaggcgttttcg
gcctacgagggcacggtggcgctgctggtgaacaccgccagcgagtgcggctatacgcgg
caatatgccggcctgcaggagctgcaggattatttcgccggccaggccttcgcggtgctc
ggctttccgtgcaatcagttcggcggccaggaaccgggcagcgagcaggagatcctggct
ttctgccagggacgcttcggcgtgtccttcccgctgttcgccaagctggaggtcaacggc
gccggcgccgatccgctatggcgctggctgacccaggccgattcgccgcatccgcacccg
gtgaagtggaacttcaccaaattcctgatcgacgcgcgcggccgggtggtgaagcgctac
gagccggcggtcgagccgcacgagttggtcgaagacatcaaggcgctgctggccgggtga

DBGET integrated database retrieval system