KEGG   Chromobacterium sp. ATCC 53434: CXB49_06065Help
Entry
CXB49_06065       CDS       T05234                                 

Definition
(GenBank) bifunctional metallophosphatase/5'-nucleotidase
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
chro  Chromobacterium sp. ATCC 53434
Pathway
chro00230  Purine metabolism
chro00240  Pyrimidine metabolism
chro00760  Nicotinate and nicotinamide metabolism
chro01100  Metabolic pathways
chro01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:chro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CXB49_06065
   00240 Pyrimidine metabolism
    CXB49_06065
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CXB49_06065
Enzymes [BR:chro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     CXB49_06065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5_nucleotid_C Metallophos Metallophos_2
Motif
Other DBs
NCBI-ProteinID: AUH50401
UniProt: A0A2H5DTP5
Position
1271636..1273324
Genome map
AA seq 562 aa AA seqDB search
MKLVPLSLSLGVALTLSACLSNSSSVATPRDDQQRPGGAVAVKMIAFNDFHGNLEAPGQL
AVPDAAHPGQTVKVTAGGADYLAAWVQRLRQQSPNTVVVSAGDLIGASPLVSGLFHDEPT
VEAMNMLGLDLNAVGNHEFDDGQDELLRMQNGGCKPGSANSCLMGRFAGASFKFLAANVT
KADGSTLFPGYAIKRYGGIPVAFIGMTLKGTPEIVSPTGVAGLSFRDEAATVNGLIPQLK
AQGVGAVVVLIHEGGYQAGSYNDCNGISGPIADIVKKLDKSVGLVVSGHTHQAYNCVIDG
RVVTSAKNYGQLFTEIDFKLDPVSHGFVPGSIQALNRPVTQDIAPRADITDLIRRYQGQA
ARVANQVVGQAAGPLSRSANAAGESALGDVIADAQLLAGAGQHAVAAFMNPGGIRADLAP
DASGNVNYKQVYTVQPFGNTMMTMDLTGAQIDQLLEQQWSASAQPKMLQVSAGFSYSWSA
SAPVGSKVDIASIRINGVQVDPAASYRVQVNNFLAGGGDGFTVLTRGVNRVGGDVDTDVL
VQYFSQRSPVAVPTLNRIVNLP
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaaactggttccgttgagcctgagcctgggcgtcgcgctgacactgagcgcctgcctg
tccaattcctcgtcggtggcgacgccccgcgacgatcagcagcgaccgggcggggctgtg
gccgtcaagatgatcgccttcaacgatttccacggcaatctggaggcgccaggacagctt
gcggtgccggacgcggcgcatccggggcagaccgtcaaggtgacggccggcggcgccgac
tacctggcggcctgggtgcagcgcctgcgccagcagtcgccgaacaccgtggtggtgtcg
gccggcgatctgataggcgccagcccgctggtgtccggcctgtttcatgacgagccgacc
gtcgaggcgatgaatatgctggggctggacctgaacgcggtcggcaaccacgaattcgac
gacggccaggacgagctgttgcggatgcagaacggcggctgcaagcccggttcggccaat
agctgcctgatgggccgcttcgccggcgccagtttcaagttcctggcggctaatgtcacc
aaggccgacggcagcacgctgttccccggctatgcgatcaagcgctacggcggcattccg
gtggccttcatcggcatgacgctgaaaggcacgccggaaatcgtgtcgccgaccggcgtc
gccgggctgagcttccgggacgaggccgccaccgtcaacggcctgattccgcaattgaag
gcgcagggagtcggcgcggtggtggtgctgatacatgaaggcggctaccaggccggcagc
tacaacgactgcaacggcatttccgggccgatcgccgacatcgtcaagaagctggacaag
tcggttggcctggtggtcagcggacatacccatcaggcttacaactgcgtgatagacggc
cgcgtcgtcaccagcgccaagaattacggccagctgttcaccgagatcgatttcaagctc
gatccggtcagccacggtttcgtgccgggttcgatccaggccttgaaccgtccggtgacg
caggacatcgcgccgcgcgccgacatcacggacctgatccggcgttatcaaggccaggcg
gcgcgggtcgccaaccaggtggtcgggcaggctgcggggccgctgagccgcagcgccaac
gccgccggcgaatcggcgctcggcgatgtcatcgccgacgcgcagctgctggccggagcc
ggccagcacgcggtggcggctttcatgaatccgggcggcatccgcgccgacctggcgccg
gacgcgagcggcaacgtcaattacaagcaggtctacaccgttcagccgttcggcaatacg
atgatgacgatggatctgaccggcgcgcagatcgaccagttgttggagcaacagtggagc
gcgtcggcccagccgaagatgctgcaggtgtcggccggcttcagctatagctggagcgca
tcggcgccggtcggcagcaaggtcgacatcgccagcatccgcatcaacggcgtccaggtc
gatcccgcggccagctaccgggtgcaggtcaacaacttcctggccggcggcggcgacggc
ttcaccgtgctgactcgcggcgtcaaccgcgtcggcggcgatgtcgacaccgatgtgttg
gtacagtacttcagccagcggtcgccggtggcggtgccgacgctgaaccgtatcgtcaac
ttgccctga

DBGET integrated database retrieval system