KEGG   Chromobacterium sp. ATCC 53434: CXB49_10285Help
Entry
CXB49_10285       CDS       T05234                                 

Definition
(GenBank) pseudouridylate synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
chro  Chromobacterium sp. ATCC 53434
Brite
KEGG Orthology (KO) [BR:chro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:chro03016]
    CXB49_10285
Enzymes [BR:chro01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     CXB49_10285
Transfer RNA biogenesis [BR:chro03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    CXB49_10285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AUH51170
UniProt: A0A2H5DVV4
Position
2273403..2274149
Genome map
AA seq 248 aa AA seqDB search
MLQILYRDDRLIAIHKPAGLLVHRTVLDRHETRFAVQLLRDQIGQRVYPVHRLDKGTSGA
LLFALDKDAGREMSWQFERQQVDKRYLAVVRGHTDDAGHIDHPLNRRPDDLEWIGETMET
APQPAVTDYRTLARAELPIMVERYPTSRYSLLELTPQTGRRHQLRRHLKHIAHPIIGDST
YGKGRHNRMFADELDCRRMLLACVEMRLTLPDGGPLLLRCPLERDFSALLSRLGWLDAVG
AAGIESTI
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaaatactctatcgggacgatcgcctgatcgccatccacaagcccgccggcctg
ctggtgcaccgcaccgtgctggaccgccacgaaacccgcttcgccgtccagttgctgcgc
gaccagatcggacaacgcgtctatccggtgcaccggctggacaagggcacctcgggtgcg
ctgctgttcgcgctggacaaggacgccggccgcgagatgagctggcagttcgagcgccag
caggtggacaagcgctacctggcggtggtgcgcggccataccgacgacgccggacatatc
gaccacccgctgaaccgccgccccgacgatctggaatggataggcgagacgatggaaacc
gcgccgcagcctgccgtcaccgactaccgcacgctggcccgcgcagagctgcccatcatg
gtggaacgctaccccacgagccgctacagcctgctggagctgacgccgcagaccggccgc
cgccaccagctgcgccgccacctgaagcatatcgcccatcccatcatcggcgattccacc
tacggcaagggccgccacaaccggatgttcgccgacgagctggactgccgccgcatgctg
ctggcctgcgtcgaaatgcggctgacgctgccggacggcggcccgctgctgctgcgctgc
ccgctggagcgagacttctccgcgctgttgtcgcgcctgggctggctcgacgccgtcggc
gccgccggaatcgaatcaaccatctga

DBGET integrated database retrieval system