KEGG   Chromobacterium sp. ATCC 53434: CXB49_11570Help
Entry
CXB49_11570       CDS       T05234                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
chro  Chromobacterium sp. ATCC 53434
Brite
KEGG Orthology (KO) [BR:chro00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    CXB49_11570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 YidC_periplas
Motif
Other DBs
NCBI-ProteinID: AUH51409
UniProt: A0A2H5DWK4
Position
complement(2553147..2553527)
Genome map
AA seq 126 aa AA seqDB search
MADKTYQMAVEAEPQYIAEQSNVTNDIYVFGYRVRITNTGSEPAQLVSRHWIITDANHQV
QEVRGMGVVGEQPHLAPGQAFEYSSATHLKTPYGSMKGCYQLVADDGRRFEAEIPEMTLV
APRVLH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaagacctaccaaatggcggtggaggccgagccgcaatacatcgccgagcag
tccaacgtcaccaatgatatctacgtgttcggctaccgcgtccgcatcaccaataccggc
agcgagccggcccagctggtcagccgccactggatcatcaccgacgccaaccaccaggtg
caggaagtgcgcggcatgggcgtcgtcggcgagcagccgcatctggccccgggccaggcg
ttcgagtattccagcgccacccatctgaagacgccgtacggcagcatgaagggctgttac
cagttggtggccgacgacggcaggcgcttcgaggccgaaatccccgagatgacgctggtg
gcgccgagggtgctgcactaa

DBGET integrated database retrieval system