KEGG   Chromobacterium sp. ATCC 53434: CXB49_20415Help
Entry
CXB49_20415       CDS       T05234                                 

Definition
(GenBank) aminopeptidase
  KO
K05994  bacterial leucyl aminopeptidase [EC:3.4.11.10]
Organism
chro  Chromobacterium sp. ATCC 53434
Brite
KEGG Orthology (KO) [BR:chro00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:chro01002]
    CXB49_20415
Enzymes [BR:chro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.10  bacterial leucyl aminopeptidase
     CXB49_20415
Peptidases [BR:chro01002]
 Metallo Peptidases
  Family M28: aminopeptidase Y family
   CXB49_20415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M28 Peptidase_M20 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: AUH52982
UniProt: A0A2H5E105
Position
4587360..4588607
Genome map
AA seq 415 aa AA seqDB search
MLKLRQTALLVLLGLAGAAQAQPVWISVGDQGYQLLRKIDTGVKSQENRKLAADGRLAKG
DAAGETVHLVQVDEALLPKLSDAIHENLRHCGGFIVHRDLQEARAALNGPAAPLAKTVAP
SYAIDNQAVVNKLLPQLQDSNVLGTIQSLSNYQNRFYTTSHGVNASNWIAAQWKQLAGSR
TDVTVEQFAHAGWPQKSVILTIKGSDNAAETIVLGGHLDSTIGSGTGESSRAPGADDDAS
GVASLTEVARVLLAGNYQPRRTIKFIAYSAEEVGLRGSADIAKRYKQQQANVVGALQLDM
TNYQGDAQDVFLITDHTNAAQNAFVADLAASYLPALKVGYSQCGYACSDHASWTAQGYAA
SFPFESSLDHHNPYIHTSRDTLANSGNQARHALKFSQLALAYAVELGSDGPAQAL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaactacgtcaaaccgcgctgctggtcctgctgggcctggccggcgccgcccag
gcccagccggtctggatttcggtaggcgatcagggctaccagttgttgcgcaagatagac
accggcgtcaagagccaggaaaaccgcaagctggcggccgacggccgcctcgccaaaggc
gacgccgccggcgaaaccgtgcacctggtacaggtggacgaggcgctgctgcccaagctg
tccgacgccatccacgaaaacctgcgccactgcggcggcttcatcgtacaccgcgacctg
caggaagcccgcgccgcgctgaacggcccggccgcgccgctggccaagaccgtcgcgccc
agctacgcgatagacaaccaggccgtcgtcaacaagctgctgccgcaactgcaggacagc
aatgtgctgggcaccatccagtcgctgtccaattaccagaaccgcttctacaccaccagc
cacggcgtcaacgcgtccaactggatcgccgcccagtggaaacagctggccggcagccga
accgacgtcaccgtcgagcagttcgcccacgccggctggccgcagaaatcggtgatcctg
accatcaagggcagcgacaacgcggcggaaaccatcgtgttgggcggccatctggactcg
accataggcagcggcaccggcgaaagcagccgcgcgccgggcgccgacgacgacgcctcc
ggcgtggccagcctgaccgaggtcgcgcgcgtgctgctggccggcaactaccagccgcgt
cgcacgatcaagttcatcgcctactcggccgaggaggtcggcctgcgcggctcggccgac
atcgccaaacgctacaaacagcaacaggccaatgtggtcggcgcgctgcaactggacatg
accaattaccagggcgacgcgcaggacgtcttcctgatcaccgaccacaccaacgccgcg
cagaacgctttcgtcgccgacctggccgcaagttatcttccggcgctgaaagtgggctac
agccagtgcggctacgcctgctccgaccacgcctcgtggacggcccagggttacgcggcg
tcgttcccgttcgagtccagcctcgaccatcacaacccctacatccacaccagccgcgat
acgctggccaactccggcaaccaggccagacacgcgctgaagttctcgcagctggcgctg
gcctacgcggtggaactgggcagcgacggcccagcccaagcgctctga

DBGET integrated database retrieval system