KEGG   Chryseobacterium sp. 3008163: EAG08_05140Help
Entry
EAG08_05140       CDS       T05679                                 

Gene name
pruA
Definition
(GenBank) L-glutamate gamma-semialdehyde dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
chrs  Chryseobacterium sp. 3008163
Pathway
chrs00250  Alanine, aspartate and glutamate metabolism
chrs00330  Arginine and proline metabolism
chrs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chrs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EAG08_05140 (pruA)
   00330 Arginine and proline metabolism
    EAG08_05140 (pruA)
Enzymes [BR:chrs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     EAG08_05140 (pruA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AYM99806
UniProt: A0A3G2G4X6
Position
1148660..1150285
Genome map
AA seq 541 aa AA seqDB search
MSKAISQVPFAVNEPVNSYEPGSPEVKSLIAQYKKMWAQKIEIPMVINGKEVKTDDKVQL
QSPQDHAHDFGFYHRGTMQHVDDAINAALAAKKQWNDLGWEHRAAIFLKAADLLAGPYRD
VINAATMIGQSKNVHQAEIDAACEFIDFLRFNVEFMTEMYSEQPVSDAGIWNRVEYRPLE
GFVFAVTPFNFTAISGNLPACMAMLGNVVVWKPSDKQIYSAKVIMDVLTEAGLPAGVINM
IFTDGKETAEKVLAHRDFAGLHFTGSTKVFQGMWKMIGDNIHNYRTYPRIVGETGGKDFV
IAHPSANVEAVATGLVRGSFEYQGQKCSAASRAYIPRSLWADVKKVMETQIASIKIGSPE
DPSNFVNAVIDKNSFEKCKGYIDRAEASSNANVIIGGKCDDSKGWFVSPTVIETTDPQYE
SMVEEIFGPILSVYVYEDKDWTETLKIVDSSSPYSLTGSVFSQDRYATDEAFKALENASG
NFYINDKPTGAVVGQQPFGGGRASGTNDKAGSKMNLLRWTSVRSIKETFVSPKDYKYPYL
G
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagcaatttcgcaagtaccatttgcagtaaacgaaccggtaaattcttacgaa
ccgggttctccggaagtaaaatctctgatcgctcaatacaaaaaaatgtgggcacagaaa
atcgagattccaatggttatcaatggtaaagaagtcaaaactgacgataaagttcagctt
cagtctcctcaggatcacgctcatgatttcggattctaccacagaggaacaatgcaacat
gtagatgatgccatcaacgctgctttagctgctaaaaaacagtggaatgacttgggttgg
gaacaccgagcagccattttcttaaaagctgctgatcttttggcaggtccttacagagat
gtgatcaacgctgctacaatgatcggacagagtaaaaatgttcatcaggcagaaattgat
gcagcttgtgagttcatcgatttcttaagattcaacgtagaattcatgacagaaatgtat
tctgagcagccggtttctgatgcaggaatctggaatcgtgtagaatacagacctttagaa
ggattcgtttttgcagttactcctttcaactttaccgcaatctcaggaaacttgccggct
tgtatggcaatgcttggaaacgttgtggtttggaagccgtcagataaacaaatctactct
gcaaaagtaatcatggatgttcttactgaagctggtcttccagcaggggtaatcaacatg
attttcacagacggaaaagaaactgctgagaaagttttggcacacagagattttgcagga
cttcactttacaggttccacaaaagttttccagggaatgtggaaaatgattggtgacaat
attcataactacagaacatacccaagaatcgttggagaaacaggtggaaaagattttgta
atcgctcacccttctgctaacgtagaagcagttgcaacaggtttggtaagaggttcattt
gaatatcaaggacagaaatgttctgcggcttcaagagcttacattccaagatcactttgg
gcagacgtaaaaaaagtaatggaaactcagattgcatccattaaaattggttcacctgaa
gatccttccaactttgtgaatgcagtaatcgacaaaaactctttcgaaaaatgtaaaggc
tatatcgacagagctgaagcgtcgagcaatgcaaatgtaattatcggtggaaaatgtgac
gattctaaaggatggttcgttagccctacagtaatcgagactactgatcctcaatatgaa
agtatggtagaggaaatcttcggcccaatattatcagtttacgtttatgaagacaaagat
tggacagaaacacttaaaatagtagattcttcatctccttattcattaacaggttctgtg
ttttcacaagacagatatgcaactgacgaagctttcaaagctttagaaaatgcttctgga
aatttctacatcaatgacaaaccaactggtgcagttgtaggacagcaacctttcggtgga
ggaagggcttcaggaactaacgataaagcaggttctaaaatgaacttactaagatggact
tctgtaagaagtattaaagaaactttcgtttctcctaaagattataaatacccatatttg
ggataa

DBGET integrated database retrieval system