KEGG   Chryseobacterium sp. 3008163: EAG08_06290Help
Entry
EAG08_06290       CDS       T05679                                 

Gene name
mqo
Definition
(GenBank) malate dehydrogenase (quinone)
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
chrs  Chryseobacterium sp. 3008163
Pathway
chrs00020  Citrate cycle (TCA cycle)
chrs00620  Pyruvate metabolism
chrs01100  Metabolic pathways
chrs01110  Biosynthesis of secondary metabolites
chrs01120  Microbial metabolism in diverse environments
chrs01130  Biosynthesis of antibiotics
chrs01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:chrs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EAG08_06290 (mqo)
   00620 Pyruvate metabolism
    EAG08_06290 (mqo)
Enzymes [BR:chrs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     EAG08_06290 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase Pyr_redox_2 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AYM99993
UniProt: A0A3G2G651
Position
complement(1386451..1387956)
Genome map
AA seq 501 aa AA seqDB search
MPNTILSRTPKPKYDVVLIGGGIMSATLATLLHEFDPNLEIAIFERLGRFAKESTAAWNN
AGTGHSAFCELNYTPENEDGTIDISKAEKIAEQFEISKQFWSYLIDKKYISTPSDFINSC
AHMSLVFGEKDAEYLKKRHDAMKDSPLFSAMEFSTDHDQLREWIPLVMSKRNESEVLAAT
KMDLGTDVNFGSLTRKMGRHLLEDSNVEVFLYHEVKDIDPRDDGKWEMKVKDRIHSHKQE
VVADFVFIGAGGYALPLLESSDIKESEGYGGFPVSGEWLVTHNPELVEKHQAKVYTQATV
DAPPMSVPHLDLRIIDGKKALLFGPFAGFSTKFLKEGNYLDLPASVNTKNIKSLFGAWWH
NIPLTKYLVQQVAMTKAQRIQHLREFVKDAKEEDWELKVAGQRVQVIKKDGKQGGKLEFG
TEVVVNQQGTIASLLGASPGASTAVFAMVNILEKCFPEKINGEWKEKLLEMIPSYGQKLA
NNPELTEKVRAYSKEKLELKH
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgccgaatacaattttaagcagaacgccaaaaccaaaatacgacgttgttttaatcgga
ggcggaattatgagtgccactttagcaactttacttcacgaatttgacccaaatcttgaa
atagcaatttttgaaagactcggaagatttgccaaagaaagtactgccgcttggaataat
gcaggaacagggcattcagctttctgcgaattgaattatacaccggaaaatgaagacgga
acaatcgatatttcaaaagcagaaaaaattgccgaacaatttgaaatttcaaaacagttt
tggtcttatcttattgacaaaaaatatatttctactccttcagatttcatcaattcttgt
gcacacatgagtctggtatttggagaaaaagatgccgaatatcttaaaaaacgccacgat
gcgatgaaagattctccattgttttcagcaatggaattttcaactgatcatgaccaacta
agagaatggattcctttggtgatgagcaaaagaaatgaatcagaagttctggcagccaca
aaaatggatttgggaaccgatgttaatttcggaagcttaactcgaaaaatggggagacat
ctgcttgaagactccaatgtggaagttttcttgtatcatgaagtaaaagacatcgaccca
agagatgatggaaagtgggaaatgaaggtcaaagacagaatccacagtcataagcaggaa
gtggttgcagactttgttttcatcggagccggagggtatgcattgccgttattggaaagt
tcagacattaaagaaagcgaaggctacggcggttttccggtttccggagaatggttggtg
acgcacaatcctgagttggtagaaaaacatcaggcaaaagtgtacactcaggcaactgtc
gatgcaccgccaatgtcggttccgcatttagatttaagaattattgatggtaaaaaagcc
ttgttgtttggtccgtttgccggattttccactaaatttttaaaagaaggaaattatctt
gatttgcctgcaagtgtcaacacaaagaatatcaaatcattgttcggggcttggtggcat
aatattccactgacaaaatatctggttcagcaggttgcgatgaccaaagctcagagaatt
cagcatttaagagaatttgtgaaagacgccaaagaagaagattgggaactgaaagttgca
ggacaacgtgttcaggtcatcaaaaaagacggtaaacaaggcggaaaacttgaattcgga
accgaggtcgtagttaatcaacaaggcacgattgcatctttattgggtgcttctccagga
gcttcaacagcagtttttgcaatggttaatattcttgaaaaatgttttcctgaaaaaatc
aatggagaatggaaagaaaaattattggaaatgattccgtcttatggacagaaattagcc
aacaatcctgaacttacagagaaagtgagagcttacagcaaagaaaaattagaactcaaa
cattaa

DBGET integrated database retrieval system