KEGG   Chryseobacterium sp. 3008163: EAG08_19515Help
Entry
EAG08_19515       CDS       T05679                                 

Gene name
apaG
Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
chrs  Chryseobacterium sp. 3008163
Brite
KEGG Orthology (KO) [BR:chrs00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    EAG08_19515 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AYN02192
UniProt: A0A3G2GCW5
Position
4172572..4172958
Genome map
AA seq 128 aa AA seqDB search
MFSKITSNIKVSVTPEYDSKNSYPSENRFVFKYNIVIENEGDFPIKILKRKWLIFDVGFG
FTEVVGDGVIGLTPDIQPNDQFAYFSNVMLRSGVGNMSGMYLVRNEETHENFEIDIPKFN
LLSAILVN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgttttctaaaattacttcgaatattaaggtgtctgtgacccctgaatatgatagcaaa
aattcctatccttctgaaaaccgatttgtttttaaatacaacatcgtgatagaaaatgaa
ggagattttcccatcaaaattctaaaaagaaaatggctcatctttgatgtaggatttggt
ttcactgaggttgtaggagatggtgtaatcggtctcactcccgatatacagcccaatgat
cagttcgcttatttttcaaacgttatgctgcgttcaggcgttggaaatatgagtggaatg
tatctggtaagaaacgaagaaactcatgaaaattttgagattgatattccaaaattcaat
ttactttctgctattcttgtcaattaa

DBGET integrated database retrieval system