KEGG   Chryseobacterium sp. T16E-39: CEY12_04485Help
Entry
CEY12_04485       CDS       T04952                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
chry  Chryseobacterium sp. T16E-39
Pathway
chry00260  Glycine, serine and threonine metabolism
chry01100  Metabolic pathways
chry01110  Biosynthesis of secondary metabolites
chry01120  Microbial metabolism in diverse environments
chry01130  Biosynthesis of antibiotics
chry01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:chry00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CEY12_04485
Enzymes [BR:chry01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     CEY12_04485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2 Toprim
Motif
Other DBs
NCBI-ProteinID: ASK29401
UniProt: A0A220S7D1
Position
complement(1028130..1029158)
Genome map
AA seq 342 aa AA seqDB search
MKFSFKNDYSEGCHPNILQALLQSNLEQEAGYGEDQYSLQAKELIREKTGNKNCAIYFVS
GGTQANLIVISSILKPYQAAISASTGHVLNNETGAIEATGHKVLSIETADGKLRPSDIIP
VLESHTNVPHQVMPKLVYISNSTELGTIYTARDLEELSAFCKERNLYLFMDGARLGHGLT
AEISDLTLEKVAQLTDVFYLGGTKNGALIGEAIVINNPILQEDFGFNIKQKGALLAKGRL
LGIQFLELMKNNLYFDLARHANQQAMKIKNALQERGVAFLSVTYTNQIFPILSNELIEVL
SEKFEFYVWKKIDDQYSAIRLITSWNTPDQGVNDFIQIIKTN
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttcattcaaaaacgattactcagaggggtgtcaccctaatatattacaagca
cttttacaatcaaatcttgaacaggaagcaggttatggagaagatcaatattctttacag
gctaaggaactgatcagagagaaaacaggaaataaaaactgtgctatctattttgtttca
ggcggaacacaggccaatcttattgttatctcgtcgatcctaaaaccttatcaggcagca
atttccgcttctaccggacatgttttgaataatgagaccggcgccattgaagcaacaggc
cataaggttttaagtattgaaacagcggatggaaaattaaggccgtcagatatcatccca
gttctggaaagtcacacgaatgttccccatcaggtaatgccaaaattggtatatatttct
aattcgacagagttaggaacaatttatacagcacgggatcttgaggaattgtctgcattt
tgtaaagagagaaatttatatctttttatggatggcgcaagattagggcatggtttaaca
gctgaaataagtgatttgactttagaaaaagtcgctcagctaacagatgttttttatttg
ggaggaactaaaaacggagctttaataggagaggctattgtcataaataatcctattctt
caggaagattttggctttaacatcaaacaaaaaggagccttgctggcgaaagggcgactt
ctcggaattcagtttttggaactgatgaaaaataatctttattttgaccttgctagacat
gccaatcaacaggcgatgaaaataaaaaatgctttacaggaaagaggagttgcttttctc
tctgtgacgtataccaaccagatatttccgattttaagtaatgaactgattgaggtttta
tctgagaaatttgaattttatgtctggaagaagatagacgatcaatattctgcgatcagg
ttaattacttcctggaatactcctgatcagggagtgaatgattttattcaaatcataaaa
acgaattaa

DBGET integrated database retrieval system