KEGG   Chryseobacterium sp. T16E-39: CEY12_08065Help
Entry
CEY12_08065       CDS       T04952                                 

Gene name
pruA
Definition
(GenBank) 1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
chry  Chryseobacterium sp. T16E-39
Pathway
chry00250  Alanine, aspartate and glutamate metabolism
chry00330  Arginine and proline metabolism
chry01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chry00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CEY12_08065 (pruA)
   00330 Arginine and proline metabolism
    CEY12_08065 (pruA)
Enzymes [BR:chry01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     CEY12_08065 (pruA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh AIMP2_LysRS_bd
Motif
Other DBs
NCBI-ProteinID: ASK30069
UniProt: A0A220S976
Position
1785616..1787241
Genome map
AA seq 541 aa AA seqDB search
MSKAISQVPLAVNEPVNSYEPGSAEVKSLIATYKKMWAEKIEIPMVINGKEVKTDEKVQL
QSPQDHAHDFGFYYKGTMQHVDDAINAALAAKKEWNELGWEQRAAIFLKAADLLAGPYRD
VINAATMIGQSKNVHQAEIDSACEFIDFLRFNVEFMTEMYSEQPISDNGIWNRVEYRPLE
GFCFAVTPFNFTAISGNLPTCMAMLGNVVVWKPSDKQVYSAKVIMDVLTEAGLPAGVINM
IFTDGKDTAEKVLAHRDFAGLHFTGSTKVFQGMWKMIGDNIHNYRTYPRIVGETGGKDFV
IAHPSANVEAVATGLVRGAFEYQGQKCSAASRAYIPKSLWEDVKKVMEAQMSTIKIGSPE
DPSNFVNAVIDKNSFEKCKGYIERAQNSGEAKIAIGGNCDDSKGWFVSPTVIETTNPQYE
SMVEEIFGPILSIYVYEDKDWKETLQVVDSSSPYSLTGSVFAQDRYAINEAFKALENASG
NFYINDKPTGAVVGQQPFGGGRASGTNDKAGSKMNLLRWTSVRSIKETFVSPKDYKYPYL
G
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagcaatttcgcaagttccacttgcagtgaatgagcccgtaaactcttatgaa
ccaggttcagctgaagtaaaaagccttattgccacatacaaaaaaatgtgggctgaaaag
atagaaatcccaatggtcattaacggaaaagaagtaaaaactgacgaaaaagttcagctt
cagtctcctcaggatcatgctcatgattttggtttttattataaaggaacgatgcaacat
gtggatgatgcgatcaatgctgcattggctgcaaaaaaagaatggaatgagcttggatgg
gagcagcgagctgcgatcttcttaaaagcggctgatcttttagcaggaccttacagagat
gtgatcaatgctgctacaatgatcggacaatctaaaaatgtacaccaggctgaaattgac
tcagcttgtgaattcatagatttcttaagattcaatgttgagtttatgacagaaatgtat
tctgaacagccaatctctgataacgggatctggaatcgtgtagaatacagaccattagaa
ggattctgttttgcagtaactccatttaactttaccgcaatttcaggaaacctgccaact
tgtatggcaatgcttggaaacgtagtggtttggaagccttctgataagcaggtttattct
gctaaagtaatcatggatgtattaactgaagcaggtcttcctgcaggggtaatcaatatg
atcttcacagatggaaaagatactgctgaaaaagtattggcacaccgtgattttgcagga
cttcactttacaggttctacaaaagttttccagggaatgtggaaaatgatcggagataat
attcataactacagaacatacccaagaatcgttggagaaactggaggtaaggatttcgtt
attgctcacccttctgcaaacgttgaagcagtagctacaggtttggtaagaggtgctttc
gaataccaggggcaaaaatgttctgcagcttcaagagcatatattcctaaatcgctttgg
gaagatgtgaaaaaagtaatggaagctcaaatgagtaccattaaaataggttctccggaa
gatccatcaaactttgtcaatgcagtaattgataaaaattctttcgaaaaatgtaaagga
tatatcgaaagagctcaaaactctggagaagctaaaattgcaatcggcggaaactgtgat
gattctaaaggatggtttgtaagcccaacagtgattgaaactactaaccctcaatatgaa
agcatggttgaagaaatcttcggtcctatcttaagcatctatgtatacgaagataaagac
tggaaagaaacattacaggtagtggattcttcttctccatattcattaacaggttctgtt
tttgcccaagaccgttatgctataaatgaagctttcaaagcgttagaaaatgcatcaggt
aatttctacatcaatgataaaccaacaggtgctgtagttggacaacagcctttcggtgga
ggtagagcttcaggaacaaatgataaagcaggttctaaaatgaatcttcttagatggact
tctgtaagaagtatcaaagaaacttttgtttctcctaaagattataaatacccatacttg
ggataa

DBGET integrated database retrieval system