KEGG   Chryseobacterium sp. T16E-39: CEY12_08195Help
Entry
CEY12_08195       CDS       T04952                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
chry  Chryseobacterium sp. T16E-39
Pathway
chry00010  Glycolysis / Gluconeogenesis
chry00053  Ascorbate and aldarate metabolism
chry00071  Fatty acid degradation
chry00280  Valine, leucine and isoleucine degradation
chry00310  Lysine degradation
chry00330  Arginine and proline metabolism
chry00340  Histidine metabolism
chry00380  Tryptophan metabolism
chry00410  beta-Alanine metabolism
chry00561  Glycerolipid metabolism
chry00620  Pyruvate metabolism
chry00625  Chloroalkane and chloroalkene degradation
chry01100  Metabolic pathways
chry01110  Biosynthesis of secondary metabolites
chry01120  Microbial metabolism in diverse environments
chry01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:chry00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CEY12_08195
   00053 Ascorbate and aldarate metabolism
    CEY12_08195
   00620 Pyruvate metabolism
    CEY12_08195
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CEY12_08195
   00561 Glycerolipid metabolism
    CEY12_08195
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CEY12_08195
   00310 Lysine degradation
    CEY12_08195
   00330 Arginine and proline metabolism
    CEY12_08195
   00340 Histidine metabolism
    CEY12_08195
   00380 Tryptophan metabolism
    CEY12_08195
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CEY12_08195
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CEY12_08195
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CEY12_08195
Enzymes [BR:chry01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CEY12_08195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Kinetochor_Ybp2
Motif
Other DBs
NCBI-ProteinID: ASK30094
UniProt: A0A220S9A3
Position
1812105..1813424
Genome map
AA seq 439 aa AA seqDB search
MTSELEQKIRTVFEKQKTFFKTNQTKNIEFRKAQLTKFREVFLGHTDALCEALDIDLGKS
RKEAEYVEIQIVSSELDYLLENIDDWAQPTPVESKPHPSGAEIVSKIMYEPYGVNYIIGP
FNYPVQLTFSPLIGALIAGNTAIIKPSENTPHVAKVIEKIIEEAFDESYVKVFQGAIEEN
TLLLSLPFDYIFFTGSPNVGKIVMKAAAEQLIPLTLELGGKSPTIVHKDADIDKAVARIS
YGKWINCGQTCVAPDYIYIHESVKETFVNKFIAYLKTTYPEGSLGKIGKIVSPNQIKHLA
GYLEAAPDKVIYGGKYDLETRHFEATLMDNITWDDQVMQQEIFGPILPIMTYTDIDNALE
EINSRPKPLALYVFSESQEFADDVLSRTTSGDAEINSAIIHVGSHFLPFGGVGTSGMGKY
HGKFSFEAFSHSRSVLQVK
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgacatcagaattagaacaaaaaatcaggactgttttcgaaaaacaaaaaacgtttttt
aaaaccaatcaaaccaagaatattgaattcagaaaggcacagctaaccaaattccgtgag
gtatttcttgggcatacggatgcactttgtgaagccttggacatcgacctgggaaaaagc
aggaaagaagcagaatatgtagaaattcaaattgtatccagcgaactggattaccttctg
gaaaatattgatgactgggcccagcctactccggtagaatccaaaccacatccgtccgga
gctgaaattgtgagtaaaataatgtatgaaccttatggcgtaaattatatcattggtccg
ttcaattatcctgtacagcttacgttcagtcctttaatcggagcgttaattgcaggaaat
accgccattatcaaaccatctgaaaacactccccacgttgcaaaagtgattgaaaagatc
atagaagaagctttcgatgaatcttatgtcaaagtgtttcaaggtgctatagaagaaaat
accttattattaagtcttcctttcgattatatattctttacaggaagtcctaatgtcggt
aagattgtgatgaaagctgctgctgaacaattgattccgcttacacttgaattaggaggt
aaatcgccaacgattgtacataaagatgccgatatagataaagctgtagcaagaatctcc
tacggaaagtggatcaattgcggacaaacctgtgtggctcccgattatatttatattcat
gaatctgtaaaagaaacttttgtcaataagtttatcgcctatttaaagactacatatcct
gaaggatctttgggtaaaatagggaaaatcgtcagccccaatcagattaaacatcttgcc
ggatatttagaagccgcgccggacaaagtaatttacggaggtaaatacgatcttgaaacg
cggcattttgaagctacactaatggacaatataacctgggatgatcaggtgatgcaacaa
gaaatctttggtccgatcttaccgatcatgacgtatactgatatcgataacgctttggag
gaaatcaatagccgtccaaaaccccttgctttatacgttttctccgaaagccaggagttt
gctgatgatgttcttagtcgcacaacaagtggtgatgctgaaatcaacagtgcaattatc
catgttggctcacatttcctcccatttggaggtgtcggaacatccggaatgggaaaatac
cacggaaagttcagttttgaagcttttagccatagcagatctgttttacaggtaaaataa

DBGET integrated database retrieval system