KEGG   Chryseobacterium sp. T16E-39: CEY12_10385Help
Entry
CEY12_10385       CDS       T04952                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
chry  Chryseobacterium sp. T16E-39
Pathway
chry00620  Pyruvate metabolism
chry00630  Glyoxylate and dicarboxylate metabolism
chry01100  Metabolic pathways
chry01110  Biosynthesis of secondary metabolites
chry01120  Microbial metabolism in diverse environments
chry01200  Carbon metabolism
Module
chry_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:chry00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CEY12_10385
   00630 Glyoxylate and dicarboxylate metabolism
    CEY12_10385
Enzymes [BR:chry01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     CEY12_10385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ASK30489
UniProt: A0A220SAE3
Position
complement(2283970..2285544)
Genome map
AA seq 524 aa AA seqDB search
METKTQLQIKAQSQFEKIFTPELVEFLIELHQNFNSKRLDLLEERKETQLDLDRKHLPKF
LPQTEEIRNGNWVCSPLPKDLLDRRVEITGPVDRKMIINALNSGASTFMADFEDSNSPTW
KNCMEGQLNLSDAINRNIDFTNEQGKSYTLNEKTAVLLIRPRGLHLPEKHIEINGEEASG
SLIDFGIYFFRNVQQLLEKGSGPYFYLPKLEHYKEARWWNEVFDFAQNYLQIPRGTIKAT
VLIETITASFQIDEILYELKEHSSGLNCGRWDYIFSFIKKFRNLPEFIIPDRDQVTMTSP
FMTAYSKRVIEICHKRNVHAIGGMAAQIPIKNDDQANAAAFEKVKADKEREVKNGHDGTW
VAHPALVSVAKDIFDQYMPSANQIDKKVDYQIKESDLLEIPKGEISEKGVRKNINVGILY
LESWLMGVGAAAIYNLMEDAATAEISRTQIWQWLKNEAVLIDDRVLTREMVLQWEKEEMD
TIEKYVGEERFKNGKFNLAKELFNELIFSEKFEEFLTLKAYPFI
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaaacccaattacagataaaggctcagagccagtttgaaaagatattcact
cctgaacttgttgagttcctgattgaacttcatcaaaattttaattcaaaaagacttgat
cttttagaagaaagaaaagaaactcagctggatcttgacaggaaacatcttccaaagttt
ttaccacaaactgaagaaatcagaaatggaaattgggtatgctcaccattgccaaaagat
ctgttagatcgcagggtagaaattactggaccagtagaccgtaaaatgattattaacgca
ctcaactctggtgcttctacttttatggcggattttgaggatagtaattctcctacatgg
aagaactgcatggagggacaactcaatctttcagatgcaattaacagaaatatagatttt
acgaacgaacaggggaaatcctatacgcttaatgaaaaaacggctgttttgttgatccgt
ccaagaggccttcatcttcctgaaaaacatattgagatcaacggtgaggaagcttcaggt
tcgctgattgattttggtatttatttttttagaaatgtccaacagcttttggaaaaggga
agtggcccctacttttatcttccaaaattggaacattataaagaagcccgctggtggaat
gaagtttttgattttgctcaaaattatcttcagattccaaggggaacgattaaagcaaca
gttttaatagaaacgatcactgcatcttttcagatcgatgaaattttatatgaattgaaa
gagcatagttcaggattaaactgtggacggtgggattatattttttcatttattaaaaag
ttcagaaaccttcctgaatttataattcctgaccgtgatcaggtgacgatgacttctcca
tttatgacagcctattccaaaagggtgattgagatttgtcacaaacggaatgtacatgct
attggaggaatggcagcacagatccctataaaaaatgatgaccaggcaaatgcagctgcc
tttgaaaaagtaaaagcagataaagaaagggaagtgaaaaatggccatgatggtacctgg
gttgcccatcctgcactggtttcagtagcaaaagatatttttgatcaatatatgccttca
gccaaccagattgataaaaaagtagactatcagatcaaagaaagtgatctgctggaaatt
ccaaaaggggagatcagtgaaaaaggagtccgtaaaaatatcaatgtagggatcctgtat
cttgaaagctggttgatgggagtgggcgctgcggcgatttataacctgatggaagatgcg
gcaactgcagaaatttcacgcacccagatctggcagtggctgaaaaatgaagcggtatta
atcgatgacagagtactgacccgcgaaatggttcttcaatgggaaaaagaagaaatggac
accattgaaaaatatgtaggtgaagagcgttttaaaaatggaaaattcaacctggcgaaa
gagcttttcaatgaattgatcttctcggagaaatttgaagaattccttacgttgaaagcg
tatccttttatttag

DBGET integrated database retrieval system